BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0390.Seq (936 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0036 + 3217163-3217584,3217752-3218322 30 2.3 05_01_0344 - 2699464-2699520,2699788-2699939,2700592-2701039 30 3.0 11_06_0294 + 22022630-22024006,22024109-22024234,22024319-220244... 29 5.3 11_06_0278 - 21854859-21855101,21855529-21855587,21855684-218557... 29 5.3 >09_02_0036 + 3217163-3217584,3217752-3218322 Length = 330 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +3 Query: 345 ITIHWPSFYNVV-TGKTLALPNLIALQH 425 I+ W F N+V +G TL++PN + LQH Sbjct: 69 ISAGWSRFINLVQSGPTLSIPNYVLLQH 96 >05_01_0344 - 2699464-2699520,2699788-2699939,2700592-2701039 Length = 218 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -3 Query: 118 CCSLNSYLLQQCHRD 74 CC+L+S +LQQC+RD Sbjct: 202 CCTLDSSILQQCYRD 216 >11_06_0294 + 22022630-22024006,22024109-22024234,22024319-22024423, 22024525-22024659,22024798-22024847,22026487-22026545, 22026819-22026928,22027941-22028174,22028278-22028377, 22028699-22028829,22029834-22029914,22029970-22030128 Length = 888 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 407 LNRLAAHPPFASWRNSEEARTDRPSQQLRXLNG 505 L+R + PF SW N +A D+ + L LNG Sbjct: 399 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNG 431 >11_06_0278 - 21854859-21855101,21855529-21855587,21855684-21855711, 21855812-21856702,21856792-21857011,21857638-21857687, 21863174-21863284,21863379-21863483,21863568-21863693, 21863796-21865187 Length = 1074 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 407 LNRLAAHPPFASWRNSEEARTDRPSQQLRXLNG 505 L+R + PF SW N +A D+ + L LNG Sbjct: 404 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNG 436 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,269,255 Number of Sequences: 37544 Number of extensions: 509154 Number of successful extensions: 1053 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1031 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1053 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2682675460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -