BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0386.Seq (852 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 24 1.8 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 23 2.3 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 23 2.3 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 23 2.3 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 7.1 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 23.8 bits (49), Expect = 1.8 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = +1 Query: 373 RQSGPAGRQNYP-RWPLSCRRNICARREIN--IPMLYVS 480 RQ P ++++P +W C C RR I IP++ +S Sbjct: 42 RQPYPRQKKSHPPQWTWQCINQRCERRHIKGAIPVVSLS 80 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 23.4 bits (48), Expect = 2.3 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = -1 Query: 564 FQRAKGFHLTVFQYHHSV 511 F +G+H+T+F+Y + Sbjct: 24 FMAKRGYHVTLFEYREDI 41 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.4 bits (48), Expect = 2.3 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = -1 Query: 564 FQRAKGFHLTVFQYHHSV 511 F +G+H+T+F+Y + Sbjct: 24 FMAKRGYHVTLFEYREDI 41 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.4 bits (48), Expect = 2.3 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = -1 Query: 564 FQRAKGFHLTVFQYHHSV 511 F +G+H+T+F+Y + Sbjct: 24 FMAKRGYHVTLFEYREDI 41 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 332 VQRT*IIADILNQTV 376 V+RT +A ILNQTV Sbjct: 197 VRRTETLAQILNQTV 211 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,468 Number of Sequences: 336 Number of extensions: 3842 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23555563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -