BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0385.Seq (845 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|c... 31 0.27 SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 29 0.63 SPAC1F12.07 |||phosphoserine aminotransferase |Schizosaccharomyc... 29 0.83 >SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 288 Score = 30.7 bits (66), Expect = 0.27 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -3 Query: 378 YFVGFQN-SEVMINRDNWGHSYCDVRGEILGSSQDEHQRKHLQ 253 Y VG+ N + ++++ WGHS+ +V E+L H + +Q Sbjct: 142 YIVGYPNEARLLMDNFKWGHSFFEVNEELLDIYAQCHDAQDIQ 184 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 29.5 bits (63), Expect = 0.63 Identities = 24/103 (23%), Positives = 49/103 (47%), Gaps = 5/103 (4%) Frame = -3 Query: 375 FVGFQNSEVMINRDNWGHSYCDVRGEILGSSQDEHQRKHLQRCFHQSRTKFRGSK----- 211 FV + ++ ++++N GH D+ + SS+DE RKH + +S+ + R SK Sbjct: 74 FVPTSSVQLNVSKNN-GHKASDIVDAV--SSKDEELRKHAKGEGKRSKNRKRSSKHSEKQ 130 Query: 210 AIRYRPSSNRKYVI*RSADVTTMARRAASGKPKILDSGGEAKQ 82 A+ + S++ + V + R+ K ++ + E K+ Sbjct: 131 AVDLKSSNSSQETSSSKGSVNNKSERSREAKSRMPKNSKEIKK 173 >SPAC1F12.07 |||phosphoserine aminotransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 389 Score = 29.1 bits (62), Expect = 0.83 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -2 Query: 175 CHLAIRRRYYNGSAGSFRETKDFGLRGGGKTNSLLASCDS 56 CH+A+ + G GS E KD G+T SL+ CD+ Sbjct: 129 CHVAVDMKELAGKYGSLPEDKDLKFTPDGET-SLVYYCDN 167 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,003,054 Number of Sequences: 5004 Number of extensions: 57746 Number of successful extensions: 141 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -