BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0385.Seq (845 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D84430-1|BAA95608.1| 589|Homo sapiens phenylalanyl tRNA synthet... 30 9.2 BC017783-1|AAH17783.1| 589|Homo sapiens phenylalanyl-tRNA synth... 30 9.2 BC006502-1|AAH06502.2| 585|Homo sapiens FARSB protein protein. 30 9.2 AF042346-1|AAD02220.1| 589|Homo sapiens putative phenylalanyl-t... 30 9.2 >D84430-1|BAA95608.1| 589|Homo sapiens phenylalanyl tRNA synthetase protein. Length = 589 Score = 30.3 bits (65), Expect = 9.2 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = -3 Query: 609 VHPSAVNTDTFCRSISSVEPGVLKNAGSNIKIPMPVLFGEVS 484 VH S T F + +++ PG+LK +N K+P+P+ E+S Sbjct: 437 VHISNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEIS 478 >BC017783-1|AAH17783.1| 589|Homo sapiens phenylalanyl-tRNA synthetase, beta subunit protein. Length = 589 Score = 30.3 bits (65), Expect = 9.2 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = -3 Query: 609 VHPSAVNTDTFCRSISSVEPGVLKNAGSNIKIPMPVLFGEVS 484 VH S T F + +++ PG+LK +N K+P+P+ E+S Sbjct: 437 VHISNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEIS 478 >BC006502-1|AAH06502.2| 585|Homo sapiens FARSB protein protein. Length = 585 Score = 30.3 bits (65), Expect = 9.2 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = -3 Query: 609 VHPSAVNTDTFCRSISSVEPGVLKNAGSNIKIPMPVLFGEVS 484 VH S T F + +++ PG+LK +N K+P+P+ E+S Sbjct: 433 VHISNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEIS 474 >AF042346-1|AAD02220.1| 589|Homo sapiens putative phenylalanyl-tRNA synthetase beta-subunit protein. Length = 589 Score = 30.3 bits (65), Expect = 9.2 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = -3 Query: 609 VHPSAVNTDTFCRSISSVEPGVLKNAGSNIKIPMPVLFGEVS 484 VH S T F + +++ PG+LK +N K+P+P+ E+S Sbjct: 437 VHISNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEIS 478 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,579,767 Number of Sequences: 237096 Number of extensions: 2230697 Number of successful extensions: 4784 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4784 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10705443456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -