BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0385.Seq (845 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-1608|ABC66062.1| 1526|Drosophila melanogaster CG3845-PC... 31 2.6 AB096103-1|BAD83642.1| 1526|Drosophila melanogaster hypothetical... 31 2.6 >AE013599-1608|ABC66062.1| 1526|Drosophila melanogaster CG3845-PC, isoform C protein. Length = 1526 Score = 30.7 bits (66), Expect = 2.6 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +1 Query: 94 PPGVQNLWFPGSCPPSHCSNVGGSLDDIFTVRTRAVSNRLRTSKFR 231 PP + W P S P H D +F R R + N+L KF+ Sbjct: 528 PPPITGRWIPPSLRPQHGLTQSEKNDAVFR-RVRGILNKLTPEKFQ 572 >AB096103-1|BAD83642.1| 1526|Drosophila melanogaster hypothetical protein protein. Length = 1526 Score = 30.7 bits (66), Expect = 2.6 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +1 Query: 94 PPGVQNLWFPGSCPPSHCSNVGGSLDDIFTVRTRAVSNRLRTSKFR 231 PP + W P S P H D +F R R + N+L KF+ Sbjct: 528 PPPITGRWIPPSLRPQHGLTQSEKNDAVFR-RVRGILNKLTPEKFQ 572 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,185,056 Number of Sequences: 53049 Number of extensions: 693675 Number of successful extensions: 1623 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1623 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4044853644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -