BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0385.Seq (845 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 23 3.5 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 4.7 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 4.7 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 4.7 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 8.2 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 23.0 bits (47), Expect = 3.5 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = -3 Query: 591 NTDTFCRSISSVEPGVLKNAGSNIKIPMPVLFGEVSRWAD 472 N DTFC+ + + + S + + F + S WAD Sbjct: 5 NQDTFCKKMRKATKEIHSISDSLVNAKLAFGFLDNSVWAD 44 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.7 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +1 Query: 310 VAIRMPPVIPINH-----YLGVLKTN 372 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.7 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +1 Query: 310 VAIRMPPVIPINH-----YLGVLKTN 372 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.7 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +1 Query: 310 VAIRMPPVIPINH-----YLGVLKTN 372 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 8.2 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -1 Query: 521 SKSLCRCSSVKCR 483 +K+LC+C + CR Sbjct: 667 NKTLCKCDAQNCR 679 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,021 Number of Sequences: 438 Number of extensions: 4479 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27188448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -