BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0384.Seq (846 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 5.3 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 7.0 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 7.0 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.2 bits (45), Expect = 5.3 Identities = 6/23 (26%), Positives = 13/23 (56%) Frame = +3 Query: 648 MIIIQKFDWDTFCNPFHLRGFXF 716 ++++ + +PFHL G+ F Sbjct: 582 IVLVDEVQQPNLSHPFHLHGYAF 604 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.8 bits (44), Expect = 7.0 Identities = 6/23 (26%), Positives = 13/23 (56%) Frame = +3 Query: 648 MIIIQKFDWDTFCNPFHLRGFXF 716 ++++ + +PFHL G+ F Sbjct: 582 VVLVDEVQSPNLSHPFHLHGYAF 604 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.8 bits (44), Expect = 7.0 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -3 Query: 337 NLSYLNGVNLIKMNLIDKDKFR-VFNEMSFHPSNI 236 NLS L V + K D DK+R +F + + N+ Sbjct: 89 NLSILTTVTIFKSAFWDVDKWRTLFTNLQYIDINL 123 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,095 Number of Sequences: 336 Number of extensions: 3884 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23348025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -