BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0384.Seq (846 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24365| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_24364| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.67 >SB_24365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 480 LTWVLNNRISSLTCQVRIECKKGMCKTNMKCIGLFFFK 593 +TW + I ++ +VR CKKG+ TN K + F K Sbjct: 34 VTWTVRKYIEAIRKEVRTYCKKGLGATNAKAVMAFHTK 71 >SB_24364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 648 Score = 31.9 bits (69), Expect = 0.67 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 480 LTWVLNNRISSLTCQVRIECKKGMCKTNMKCIG 578 +TW + I ++ +VR CKKG+ TN K +G Sbjct: 330 VTWTVRKYIEAIRKEVRTYCKKGLGATNAKGMG 362 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,284,542 Number of Sequences: 59808 Number of extensions: 395009 Number of successful extensions: 616 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2395401800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -