BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0379.Seq (470 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 9e-13 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 6e-11 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 6e-11 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 6e-11 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 64 6e-11 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 64 6e-11 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 6e-11 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 62 2e-10 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 4e-10 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 5e-10 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 60 7e-10 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 60 7e-10 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 60 9e-10 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 60 1e-09 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 60 1e-09 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 60 1e-09 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 60 1e-09 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 60 1e-09 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 60 1e-09 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 60 1e-09 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 60 1e-09 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 60 1e-09 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 60 1e-09 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 60 1e-09 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 60 1e-09 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 60 1e-09 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 60 1e-09 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 60 1e-09 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 60 1e-09 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 60 1e-09 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 60 1e-09 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 60 1e-09 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 60 1e-09 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 60 1e-09 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 60 1e-09 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 60 1e-09 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 60 1e-09 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 60 1e-09 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 60 1e-09 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 60 1e-09 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 60 1e-09 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 60 1e-09 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 60 1e-09 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 60 1e-09 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 60 1e-09 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 60 1e-09 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 60 1e-09 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 60 1e-09 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 60 1e-09 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 60 1e-09 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 60 1e-09 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 60 1e-09 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 60 1e-09 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 60 1e-09 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 60 1e-09 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 60 1e-09 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 60 1e-09 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 60 1e-09 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 60 1e-09 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 60 1e-09 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 60 1e-09 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 60 1e-09 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 60 1e-09 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 60 1e-09 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 60 1e-09 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 60 1e-09 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 60 1e-09 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 60 1e-09 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 60 1e-09 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 60 1e-09 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 60 1e-09 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 60 1e-09 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 60 1e-09 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 60 1e-09 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 60 1e-09 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 60 1e-09 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 60 1e-09 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 60 1e-09 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 60 1e-09 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 60 1e-09 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 60 1e-09 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 60 1e-09 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 60 1e-09 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 60 1e-09 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 60 1e-09 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 60 1e-09 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 60 1e-09 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 60 1e-09 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 60 1e-09 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 60 1e-09 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 60 1e-09 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 60 1e-09 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 60 1e-09 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 60 1e-09 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 60 1e-09 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 60 1e-09 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 58 4e-09 SB_17253| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 6e-09 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 6e-09 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 6e-09 SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-08 SB_51748| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-08 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-08 SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-08 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 54 6e-08 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 54 6e-08 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 54 6e-08 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 53 1e-07 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 53 1e-07 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 53 1e-07 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 53 1e-07 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 53 1e-07 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 53 1e-07 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 53 1e-07 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 53 1e-07 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 53 1e-07 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 53 1e-07 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 53 1e-07 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 53 1e-07 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 53 1e-07 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 53 1e-07 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 53 1e-07 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 53 1e-07 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 53 1e-07 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 53 1e-07 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 70.1 bits (164), Expect = 9e-13 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 223 NSPYXESYYNSWPSFYNVVTGXTLAXPNLIALQHIPLSPAG 345 NSPY WPSFYNVVTG TLA PNLIALQHIPLSPAG Sbjct: 75 NSPYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG 115 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +2 Query: 353 EXARTXRPSQQLRX*MGXW 409 E ART RPSQQLR G W Sbjct: 119 EEARTDRPSQQLRSLNGEW 137 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 64.1 bits (149), Expect = 6e-11 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 256 WPSFYNVVTGXTLAXPNLIALQHIPLSPAG 345 WPSFYNVVTG TLA PNLIALQHIPLSPAG Sbjct: 8 WPSFYNVVTGKTLALPNLIALQHIPLSPAG 37 Score = 32.7 bits (71), Expect = 0.16 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +2 Query: 347 NSEXARTXRPSQQLRX*MGXW 409 NSE ART RPSQQLR G W Sbjct: 39 NSEEARTDRPSQQLRSLNGEW 59 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 64.1 bits (149), Expect = 6e-11 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 256 WPSFYNVVTGXTLAXPNLIALQHIPLSPAG 345 WPSFYNVVTG TLA PNLIALQHIPLSPAG Sbjct: 63 WPSFYNVVTGKTLALPNLIALQHIPLSPAG 92 Score = 33.1 bits (72), Expect = 0.12 Identities = 16/24 (66%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = +3 Query: 324 HPPFA-SWVIAXRPAPXALPNSCA 392 H P + + VIA RPAP ALPNSCA Sbjct: 85 HIPLSPAGVIAKRPAPIALPNSCA 108 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 64.1 bits (149), Expect = 6e-11 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 256 WPSFYNVVTGXTLAXPNLIALQHIPLSPAG 345 WPSFYNVVTG TLA PNLIALQHIPLSPAG Sbjct: 6 WPSFYNVVTGKTLALPNLIALQHIPLSPAG 35 Score = 35.1 bits (77), Expect = 0.030 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 347 NSEXARTXRPSQQLRX*MGXWQIVSXNILL 436 NSE ART RPSQQLR G W+++ N LL Sbjct: 37 NSEEARTDRPSQQLRSLNGEWRLM-RNFLL 65 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 64.1 bits (149), Expect = 6e-11 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTARN 251 + QLAKGGCAARRLSW TPG SQS RCKTTARN Sbjct: 479 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTARN 511 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -3 Query: 399 IQXRNCWEGRSVRAXSLLPSWRKG 328 I+ RNCWEGRSVRA SLL KG Sbjct: 462 IRLRNCWEGRSVRASSLLRQLAKG 485 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 64.1 bits (149), Expect = 6e-11 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 256 WPSFYNVVTGXTLAXPNLIALQHIPLSPAG 345 WPSFYNVVTG TLA PNLIALQHIPLSPAG Sbjct: 8 WPSFYNVVTGKTLALPNLIALQHIPLSPAG 37 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 64.1 bits (149), Expect = 6e-11 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 256 WPSFYNVVTGXTLAXPNLIALQHIPLSPAG 345 WPSFYNVVTG TLA PNLIALQHIPLSPAG Sbjct: 58 WPSFYNVVTGKTLALPNLIALQHIPLSPAG 87 Score = 33.1 bits (72), Expect = 0.12 Identities = 16/24 (66%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = +3 Query: 324 HPPFA-SWVIAXRPAPXALPNSCA 392 H P + + VIA RPAP ALPNSCA Sbjct: 80 HIPLSPAGVIAKRPAPIALPNSCA 103 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 63.7 bits (148), Expect = 7e-11 Identities = 28/43 (65%), Positives = 29/43 (67%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTARNCNTTXYRANW 221 + QLAKGGCAARRLSW TPG K NCNTT YRANW Sbjct: 38 LRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 Score = 45.2 bits (102), Expect = 3e-05 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 396 QXRNCWEGRSVRAXSLLPSWRKGDVLQGD*VGXRQGXPSHXVVK 265 Q RNCWEGRSVRA SLL KG G PSH VVK Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVK 65 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 62.1 bits (144), Expect = 2e-10 Identities = 27/46 (58%), Positives = 28/46 (60%) Frame = +3 Query: 273 RXDWXNPGVXQLNRLAAHPPFASWVIAXRPAPXALPNSCAXEWAXG 410 R DW NPGV QLNRLAAHPPFASW + RP P EW G Sbjct: 350 RRDWENPGVTQLNRLAAHPPFASWRNSERPHRSPFPTVAQPEWRMG 395 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 61.7 bits (143), Expect = 3e-10 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTARNCNTT 239 + QLAKGGCAARRLSW TPG SQS RCKTTA N + Sbjct: 237 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASELNVS 273 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 223 RNCWEGRSVRASSLLRQLAKG 243 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 61.3 bits (142), Expect = 4e-10 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = -1 Query: 392 CATVGKGXRCGPXRYYPAGERGMCCKAIKLGXARVXP 282 CATVGKG RCG PAGERGMCCKAIKLG A+ P Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFP 38 Score = 32.7 bits (71), Expect = 0.16 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -2 Query: 355 FAITQLAKGG--CAARRLSWXTPGXSQSXRCKTTARNCNTTXYRANW 221 FAIT + G C A +L G K NCNTT YRANW Sbjct: 14 FAITPAGERGMCCKAIKLG-NAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 60.9 bits (141), Expect = 5e-10 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +1 Query: 256 WPSFYNVVTGXTLAXPNLIALQHIPLSPAG 345 W SFYNVVTG TLA PNLIALQHIPLSPAG Sbjct: 44 WTSFYNVVTGKTLALPNLIALQHIPLSPAG 73 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 Query: 350 SEXARTXRPSQQLRX*MGXW 409 +E ART RPSQQLR G W Sbjct: 76 AEEARTDRPSQQLRSLNGEW 95 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 60.5 bits (140), Expect = 7e-10 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTAR 254 + QLAKGGCAARRLSW TPG SQS RCKTTA+ Sbjct: 199 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAK 230 Score = 49.6 bits (113), Expect = 1e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +3 Query: 273 RXDWXNPGVXQLNRLAAHPPFASW 344 R DW N GV QLNRLAAHPPFASW Sbjct: 521 RRDWENTGVTQLNRLAAHPPFASW 544 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKG 205 Score = 33.1 bits (72), Expect = 0.12 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +2 Query: 332 FRQLGNSEXARTXRPSQQLRX*MGXW 409 F NSE ART RPSQQLR G W Sbjct: 541 FASWRNSEEARTDRPSQQLRSLNGEW 566 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 60.5 bits (140), Expect = 7e-10 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTAR 254 + QLAKGGCAARRLSW TPG SQS RCKTTA+ Sbjct: 1869 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAK 1900 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 1855 RNCWEGRSVRASSLLRQLAKG 1875 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 60.1 bits (139), Expect = 9e-10 Identities = 31/65 (47%), Positives = 35/65 (53%) Frame = +3 Query: 273 RXDWXNPGVXQLNRLAAHPPFASWVIAXRPAPXALPNSCAXEWAXGKLXAXIFC*NSRXI 452 R DW NPGV QLNRLAAHPPFASW+ P L SC A I C + + I Sbjct: 148 RRDWENPGVTQLNRLAAHPPFASWLENLSPLTVNLTGSCVSGPIRKNDLALITCPSEKYI 207 Query: 453 FVKSA 467 +SA Sbjct: 208 VKQSA 212 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 492 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 522 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 472 HSPFRLRNCWEGRSVRASSLLRQLAKG 498 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 162 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 192 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 148 RNCWEGRSVRASSLLRQLAKG 168 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 24 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 54 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 239 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 269 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 225 RNCWEGRSVRASSLLRQLAKG 245 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 383 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 413 Score = 39.5 bits (88), Expect = 0.001 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -3 Query: 402 PIQXRNCWEGRSVRAXSLLPSWRKG 328 P+ RNCWEGRSVRA SLL KG Sbjct: 365 PVVLRNCWEGRSVRASSLLRQLAKG 389 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 236 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 266 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 216 HSPFRLRNCWEGRSVRASSLLRQLAKG 242 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 85 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 115 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 65 HSPFRLRNCWEGRSVRASSLLRQLAKG 91 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 666 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 696 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 646 HSPFRLRNCWEGRSVRASSLLRQLAKG 672 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 904 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 934 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -3 Query: 396 QXRNCWEGRSVRAXSLLPSWRKG 328 Q RNCWEGRSVRA SLL KG Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKG 910 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 16 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 46 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -3 Query: 381 WEGRSVRAXSLLPSWRKG 328 WEGRSVRA SLL KG Sbjct: 5 WEGRSVRASSLLRQLAKG 22 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 391 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 421 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 371 HSPFRLRNCWEGRSVRASSLLRQLAKG 397 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 240 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 270 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 226 RNCWEGRSVRASSLLRQLAKG 246 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 307 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 337 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLAKG 313 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 575 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 605 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 555 HSPFRLRNCWEGRSVRASSLLRQLAKG 581 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 422 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 452 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 408 RNCWEGRSVRASSLLRQLAKG 428 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 373 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 403 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 359 RNCWEGRSVRASSLLRQLAKG 379 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 49 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 79 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 35 RNCWEGRSVRASSLLRQLAKG 55 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 805 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 835 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 791 RNCWEGRSVRASSLLRQLAKG 811 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 65 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 95 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/41 (46%), Positives = 23/41 (56%) Frame = -3 Query: 450 FXANFNKILXLTICHXPIQXRNCWEGRSVRAXSLLPSWRKG 328 F F+++ H P + RNC EGRSVRA SLL KG Sbjct: 31 FAIAFHRLKNQGASHSPFRLRNCGEGRSVRASSLLRQLAKG 71 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 466 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 496 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 452 RNCWEGRSVRASSLLRQLAKG 472 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 85 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 115 Score = 37.9 bits (84), Expect = 0.004 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RN WEGRSVRA SLL KG Sbjct: 65 HSPFRLRNYWEGRSVRASSLLRQLAKG 91 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 24 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 54 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 31 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 61 Score = 31.1 bits (67), Expect = 0.48 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 399 IQXRNCWEGRSVRAXSLLPSWRKG 328 IQ WEGRSVRA SLL KG Sbjct: 14 IQAAQLWEGRSVRASSLLRQLAKG 37 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 24 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 54 Score = 52.8 bits (121), Expect = 1e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 273 RXDWXNPGVXQLNRLAAHPPFASW 344 R DW NPGV QLNRLAAHPPFASW Sbjct: 91 RRDWENPGVTQLNRLAAHPPFASW 114 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 Score = 33.1 bits (72), Expect = 0.12 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +2 Query: 332 FRQLGNSEXARTXRPSQQLRX*MGXW 409 F NSE ART RPSQQLR G W Sbjct: 111 FASWRNSEEARTDRPSQQLRSLNGEW 136 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 387 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 417 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 373 RNCWEGRSVRASSLLRQLAKG 393 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 24 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 54 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 1121 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 1151 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 1107 RNCWEGRSVRASSLLRQLAKG 1127 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 312 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 342 Score = 37.1 bits (82), Expect = 0.007 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -3 Query: 399 IQXRNCWEGRSVRAXSLLPSWRKG 328 I RNCWEGRSVRA SLL KG Sbjct: 295 ILLRNCWEGRSVRASSLLRQLAKG 318 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 126 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 156 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 112 RNCWEGRSVRASSLLRQLAKG 132 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 36 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 66 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 22 RNCWEGRSVRASSLLRQLAKG 42 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 10 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 40 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 24 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 54 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 47 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 77 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLAKG 53 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 52 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 82 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKG 58 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 31 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 61 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 283 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 313 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 269 RNCWEGRSVRASSLLRQLAKG 289 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 502 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 532 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 488 RNCWEGRSVRASSLLRQLAKG 508 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 267 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 297 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 253 RNCWEGRSVRASSLLRQLAKG 273 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 110 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 140 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 96 RNCWEGRSVRASSLLRQLAKG 116 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 70 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 100 Score = 37.5 bits (83), Expect = 0.006 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -3 Query: 399 IQXRNCWEGRSVRAXSLLPSWRKG 328 ++ RNCWEGRSVRA SLL KG Sbjct: 53 LRLRNCWEGRSVRASSLLRQLAKG 76 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 72 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 102 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 58 RNCWEGRSVRASSLLRQLAKG 78 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 546 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 576 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 532 RNCWEGRSVRASSLLRQLAKG 552 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 66 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 96 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 52 RNCWEGRSVRASSLLRQLAKG 72 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 171 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 201 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 157 RNCWEGRSVRASSLLRQLAKG 177 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 31 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 61 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 11 HSPFRLRNCWEGRSVRASSLLRQLAKG 37 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 256 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 286 Score = 40.7 bits (91), Expect = 6e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H I+ RNCWEGRSVRA SLL KG Sbjct: 236 HLTIRLRNCWEGRSVRASSLLRQLAKG 262 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 281 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 311 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 261 HSPFRLRNCWEGRSVRASSLLRQLAKG 287 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) Length = 446 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 54 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 84 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 40 RNCWEGRSVRASSLLRQLAKG 60 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 208 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 238 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 188 HSPFRLRNCWEGRSVRASSLLRQLAKG 214 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 144 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 174 Score = 37.5 bits (83), Expect = 0.006 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -3 Query: 399 IQXRNCWEGRSVRAXSLLPSWRKG 328 I RNCWEGRSVRA SLL KG Sbjct: 127 ITLRNCWEGRSVRASSLLRQLAKG 150 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 465 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 495 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 445 HSPFRLRNCWEGRSVRASSLLRQLAKG 471 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 115 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 145 Score = 37.5 bits (83), Expect = 0.006 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -3 Query: 399 IQXRNCWEGRSVRAXSLLPSWRKG 328 ++ RNCWEGRSVRA SLL KG Sbjct: 98 LKLRNCWEGRSVRASSLLRQLAKG 121 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 71 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 101 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 57 RNCWEGRSVRASSLLRQLAKG 77 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 134 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 164 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 120 RNCWEGRSVRASSLLRQLAKG 140 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 300 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 330 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLAKG 306 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 10 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 40 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 31 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 61 Score = 31.1 bits (67), Expect = 0.48 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 399 IQXRNCWEGRSVRAXSLLPSWRKG 328 IQ WEGRSVRA SLL KG Sbjct: 14 IQAAQLWEGRSVRASSLLRQLAKG 37 >SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 10 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 40 >SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 150 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 180 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLAKG 156 >SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) Length = 229 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 24 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 54 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 128 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 158 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 114 RNCWEGRSVRASSLLRQLAKG 134 >SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 934 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 964 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 914 HSPFRLRNCWEGRSVRASSLLRQLAKG 940 >SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 39 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 69 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 408 HXPIQXRNCWEGRSVRAXSLLPSWRKG 328 H P + RNCWEGRSVRA SLL KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 1e-09 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 ITQLAKGGCAARRLSWXTPGXSQSXRCKTTA 257 + QLAKGGCAARRLSW TPG SQS RCKTTA Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 390 RNCWEGRSVRAXSLLPSWRKG 328 RNCWEGRSVRA SLL KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,051,499 Number of Sequences: 59808 Number of extensions: 189636 Number of successful extensions: 9672 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4214 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9655 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -