Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0379.Seq
         (470 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81533-7|CAB04330.1|  290|Caenorhabditis elegans Hypothetical pr...    29   2.2  

>Z81533-7|CAB04330.1|  290|Caenorhabditis elegans Hypothetical
           protein F36G9.11 protein.
          Length = 290

 Score = 28.7 bits (61), Expect = 2.2
 Identities = 12/40 (30%), Positives = 19/40 (47%)
 Frame = +3

Query: 315 LAAHPPFASWVIAXRPAPXALPNSCAXEWAXGKLXAXIFC 434
           + A  P  + + A  P P  LP +C  EW   K  + ++C
Sbjct: 89  VGAEKPVHTTLSAPLPTPKPLPPACEKEWLSFKRKSELWC 128


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,168,044
Number of Sequences: 27780
Number of extensions: 129948
Number of successful extensions: 204
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 202
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 204
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 850313440
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)