BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0379.Seq (470 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25940.1 68415.m03113 vacuolar processing enzyme alpha / alph... 28 3.7 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 27 6.4 At1g80210.1 68414.m09387 expressed protein 27 8.5 >At2g25940.1 68415.m03113 vacuolar processing enzyme alpha / alpha-VPE identical to SP|P49047 Vacuolar processing enzyme, alpha-isozyme precursor (EC 3.4.22.-) (Alpha-VPE) {Arabidopsis thaliana} Length = 478 Score = 27.9 bits (59), Expect = 3.7 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +1 Query: 199 NSRGGPVPNSPYXESYYNSWPSFYNVVTGXTLAXPNLIAL 318 N R G + NSP E YN P Y TG + NL+A+ Sbjct: 95 NPRPGVIINSPNGEDVYNGVPKDY---TGDEVNVDNLLAV 131 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 27.1 bits (57), Expect = 6.4 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 211 GPVPNSPYXESYYNSWPSFYN 273 G VPN SY+NS+P YN Sbjct: 220 GVVPNRSSANSYFNSFPPGYN 240 >At1g80210.1 68414.m09387 expressed protein Length = 354 Score = 26.6 bits (56), Expect = 8.5 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -2 Query: 343 QLAKGGCAARRLSWXTPGXSQSXRCKTTARNCNTTXYRANWVPGPPSS 200 + +K G +A + W S+S R K + N Y +W+ PSS Sbjct: 30 EYSKDGGSATAMIWGASPQSRSDRQKDRNDDINGQNYTGHWMVPLPSS 77 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,523,032 Number of Sequences: 28952 Number of extensions: 115547 Number of successful extensions: 189 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 189 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 189 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 801831960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -