BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0377.Seq (879 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 25 3.0 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 24 5.3 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 25.0 bits (52), Expect = 3.0 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 88 AFGFLFRYNVLFINFSFYRLRFRIFNYFCFASS 186 AFG +F +N + + RLR+ F CF + Sbjct: 362 AFGAVFIFNYIPLQEGTTRLRYTFFYAVCFVET 394 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 24.2 bits (50), Expect = 5.3 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -1 Query: 153 ETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETA 25 ET+ E +V + E+K G AA + DE+ E+ A Sbjct: 345 ETQEGEKKVKDAQEAEERKKAEGEAAAEEAAKDDEDEDDEDDA 387 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 550,538 Number of Sequences: 2352 Number of extensions: 8107 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94266828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -