BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0375.Seq (864 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05680.1 68416.m00634 expressed protein 28 7.0 At3g49170.1 68416.m05374 pentatricopeptide (PPR) repeat-containi... 28 9.2 >At3g05680.1 68416.m00634 expressed protein Length = 2057 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 263 DKLGLQESCNKFIDTLVSGL 204 DKL + NKF+DT+VSG+ Sbjct: 156 DKLATNDVVNKFVDTVVSGV 175 >At3g49170.1 68416.m05374 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 850 Score = 27.9 bits (59), Expect = 9.2 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +1 Query: 601 NINSIQKFD-IFSVVRSVALRTIRPVWNLPLDMFFQWEFSDLMVRILNFGAKAFVSXWVR 777 N+ SI+K + I S V + L +PV N + M+ + D R+ NF V W Sbjct: 486 NVGSIRKGEQIHSQVVKLGLSCNQPVCNALISMYSKCGSIDTASRVFNFMENRNVISWTS 545 Query: 778 SXSXF 792 + F Sbjct: 546 MITGF 550 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,676,901 Number of Sequences: 28952 Number of extensions: 311930 Number of successful extensions: 705 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 705 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2019160800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -