BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0373.Seq (876 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 25 0.69 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 24 2.1 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 24 2.1 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 24 2.1 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 24 2.1 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 2.8 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 2.8 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 2.8 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 2.8 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 2.8 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 2.8 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 2.8 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 2.8 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 2.8 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 2.8 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 2.8 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 2.8 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 2.8 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.8 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 2.8 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 2.8 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 4.9 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 4.9 M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-... 22 8.5 M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 22 8.5 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 25.4 bits (53), Expect = 0.69 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 309 DLYFKTGDSIAFLTPPPFNHYLGVLKTNKI 398 D +FK S+ F T NHYL + K I Sbjct: 122 DSFFKNAKSVTFQTMTIPNHYLWLYKDKTI 151 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 130 GKSTTTTVEVKRDIINPEDVIVIR 153 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVIVIR 164 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVIVIR 164 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 130 GKSTTTTVEVKRDIINPEDVIVIR 153 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVILIR 164 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVILIR 164 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVILIR 164 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVILIR 164 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 130 GKSTTTTVEVKRDIINPEDVILIR 153 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVILIR 164 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVILIR 164 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVILIR 164 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVILIR 164 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVILIR 164 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 130 GKSTTTTVEVKRDIINPEDVILIR 153 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 146 GKSTTTTVEVKRDIINPEDVILIR 169 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVILIR 164 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVILIR 164 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVILIR 164 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 141 GKSTTTTVEVKRDIINPEDVILIR 164 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.6 bits (46), Expect = 4.9 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 581 YMQSEL*PVMG*VLLLDSKPIDGXASRPKSL 673 Y + V+G + LD KP+ RP SL Sbjct: 953 YQNKPISEVIGGAISLDGKPLGFPLDRPLSL 983 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 176 GFSTTWVYRLLGSIINPQNMLIVR 105 G STT + IINP++++++R Sbjct: 130 GKSTTTSVEVKRDIINPEDVILIR 153 >M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E30. ). Length = 109 Score = 21.8 bits (44), Expect = 8.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 392 VGFQNSEVMIKRGGGQK 342 + FQN IK+ GQK Sbjct: 66 IWFQNKRAKIKKASGQK 82 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 21.8 bits (44), Expect = 8.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 392 VGFQNSEVMIKRGGGQK 342 + FQN IK+ GQK Sbjct: 66 IWFQNKRAKIKKASGQK 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 252,715 Number of Sequences: 438 Number of extensions: 6082 Number of successful extensions: 45 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28402218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -