BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0358.Seq (941 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 8e-26 SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) 110 1e-24 SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 3e-23 SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 5e-23 SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) 96 3e-20 SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 2e-19 SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) 93 3e-19 SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) 93 3e-19 SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 4e-19 SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) 93 4e-19 SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) 92 5e-19 SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) 92 7e-19 SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) 91 1e-18 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 2e-18 SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 89 4e-18 SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 89 4e-18 SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 5e-18 SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 6e-18 SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 1e-17 SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 3e-17 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 3e-17 SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) 86 4e-17 SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) 85 6e-17 SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 84 2e-16 SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) 82 6e-16 SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) 75 8e-14 SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 73 4e-13 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 8e-13 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 69 6e-12 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 61 1e-09 SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 61 1e-09 SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 61 1e-09 SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 61 1e-09 SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 61 1e-09 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 60 2e-09 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 6e-09 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 5e-08 SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 50 4e-06 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 44 1e-04 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 42 7e-04 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 40 0.002 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) 38 0.012 SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) 36 0.063 SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 34 0.19 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 33 0.25 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 33 0.25 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 33 0.25 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 33 0.25 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 33 0.25 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 33 0.25 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 33 0.25 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 33 0.25 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 33 0.25 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 33 0.25 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 33 0.25 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 33 0.25 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 33 0.25 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 33 0.33 SB_13868| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.44 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 33 0.44 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_49320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_20754| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_45504| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 31 1.8 SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_28934| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_26329| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 31 1.8 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_12244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_9373| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_7163| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_56749| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_55659| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_45187| Best HMM Match : Sulfolobus_pRN (HMM E-Value=0.95) 31 1.8 SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_9584| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_3231| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_57049| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_46414| Best HMM Match : Extensin_2 (HMM E-Value=0.31) 30 2.4 SB_33025| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_25902| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_7045| Best HMM Match : rve (HMM E-Value=3.8e-22) 30 2.4 SB_3997| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 30 3.1 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 30 3.1 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 30 3.1 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 30 3.1 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 30 3.1 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 30 3.1 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 30 3.1 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 30 3.1 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 30 3.1 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 30 3.1 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 30 3.1 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 30 3.1 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 30 3.1 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 30 3.1 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 30 3.1 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 30 3.1 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 30 3.1 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 30 3.1 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 30 3.1 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 30 3.1 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_37884| Best HMM Match : Ubie_methyltran (HMM E-Value=0.00014) 30 3.1 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 30 3.1 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 30 3.1 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 30 3.1 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 30 3.1 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 30 3.1 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 30 3.1 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 30 3.1 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 30 3.1 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 30 3.1 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 30 3.1 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) 30 3.1 SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 30 3.1 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 30 3.1 SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 30 3.1 SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_14731| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 30 3.1 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 30 3.1 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 30 3.1 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 30 3.1 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 30 3.1 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 30 3.1 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 30 3.1 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 30 3.1 SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 30 3.1 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 30 3.1 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_57755| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 30 3.1 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 30 3.1 SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 30 3.1 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 30 3.1 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_54475| Best HMM Match : Adeno_VII (HMM E-Value=9.4) 30 3.1 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 30 3.1 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 30 3.1 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_53953| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 30 3.1 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 30 3.1 SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 30 3.1 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 30 3.1 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 30 3.1 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_48979| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 30 3.1 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 30 3.1 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_44498| Best HMM Match : BA14K (HMM E-Value=7) 30 3.1 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 30 3.1 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 30 3.1 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 30 3.1 SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 3.1 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 30 3.1 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 >SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 114 bits (275), Expect = 8e-26 Identities = 60/81 (74%), Positives = 63/81 (77%) Frame = +1 Query: 265 MPLDVLGRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALIT 444 MPLDVL RTRATL S P P G GN +K RAGD LQL +NEEFLVSASH+LALIT Sbjct: 1 MPLDVLDRTRATLTVSRVFPSPEGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALIT 60 Query: 445 SLPFVHTARRYYRLNDLVRSS 507 SLPFVHTARRYYRLN LVR S Sbjct: 61 SLPFVHTARRYYRLNGLVRPS 81 >SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 110 bits (265), Expect = 1e-24 Identities = 60/82 (73%), Positives = 64/82 (78%), Gaps = 1/82 (1%) Frame = +1 Query: 265 MPLDVLGRTRATLKESACSPWPR-GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 441 MPLDVLGRTRATL S + R G GN +K RAGD LQL +NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRTRATLTVSTSLSFARKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALI 60 Query: 442 TSLPFVHTARRYYRLNDLVRSS 507 TSLPFVHTARRYYRLN LVR S Sbjct: 61 TSLPFVHTARRYYRLNGLVRPS 82 >SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 107 bits (258), Expect = 1e-23 Identities = 57/81 (70%), Positives = 61/81 (75%) Frame = +1 Query: 265 MPLDVLGRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALIT 444 MPLDVLGRTRATL S + G GN +K RAGD +L NEEFLVSASH+LALIT Sbjct: 1 MPLDVLGRTRATLTVSTSLSFAGGVGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALIT 60 Query: 445 SLPFVHTARRYYRLNDLVRSS 507 SLPFVHTARRYYRLN LVR S Sbjct: 61 SLPFVHTARRYYRLNGLVRPS 81 >SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 106 bits (254), Expect = 3e-23 Identities = 58/82 (70%), Positives = 62/82 (75%), Gaps = 1/82 (1%) Frame = +1 Query: 265 MPLDVLGRTRATLKESACSPWPR-GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 441 MPLDVLGR R TL S + R G GN +K RAGD LQL +NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRPRVTLTVSTSLSFRRKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALI 60 Query: 442 TSLPFVHTARRYYRLNDLVRSS 507 TSLPFVHTARRYYRLN LVR S Sbjct: 61 TSLPFVHTARRYYRLNGLVRPS 82 >SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 105 bits (252), Expect = 5e-23 Identities = 58/82 (70%), Positives = 61/82 (74%), Gaps = 1/82 (1%) Frame = +1 Query: 265 MPLDVLGRTRA-TLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 441 MPLDVLGRTR T + P P G GN +K RAGD LQL NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRTRRYTDGVNESFPRPEGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALI 60 Query: 442 TSLPFVHTARRYYRLNDLVRSS 507 TSLPFVHTARRYYRLN LVR S Sbjct: 61 TSLPFVHTARRYYRLNGLVRPS 82 >SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 99.5 bits (237), Expect = 3e-21 Identities = 52/75 (69%), Positives = 55/75 (73%) Frame = +1 Query: 283 GRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVH 462 GRTRATL P P G GN +K RAGD +L NEEFLVSASH+LALITSLPFVH Sbjct: 4 GRTRATLTGQRVFPSPEGGGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALITSLPFVH 63 Query: 463 TARRYYRLNDLVRSS 507 TARRYYRLN LVR S Sbjct: 64 TARRYYRLNGLVRPS 78 >SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) Length = 101 Score = 96.3 bits (229), Expect = 3e-20 Identities = 55/82 (67%), Positives = 59/82 (71%), Gaps = 1/82 (1%) Frame = +1 Query: 265 MPLDVLGR-TRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 441 MPLDVLGR R T + +G GN +K RAGD LQL NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRHARYTDGVNESFLRRKGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALI 60 Query: 442 TSLPFVHTARRYYRLNDLVRSS 507 TSLPFVHTARRYYRLN LVR S Sbjct: 61 TSLPFVHTARRYYRLNGLVRPS 82 >SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 93.9 bits (223), Expect = 2e-19 Identities = 54/98 (55%), Positives = 64/98 (65%) Frame = +1 Query: 214 RGTGVFEPHEIEQYRSVMPLDVLGRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSP 393 RGTG++E + + L + +LK S +G GN +K RAGD LQL Sbjct: 29 RGTGIWEQVVSGRAQRCSNLTCISLALLSLKWMRSSQ-VKGVGNLVKYRRAGDRSLQLLI 87 Query: 394 INEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 88 LNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPS 125 >SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 93.1 bits (221), Expect = 3e-19 Identities = 47/72 (65%), Positives = 55/72 (76%) Frame = +1 Query: 292 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 471 R ++++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 121 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 180 Query: 472 RYYRLNDLVRSS 507 RYYRLN LVR S Sbjct: 181 RYYRLNGLVRPS 192 >SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) Length = 216 Score = 93.1 bits (221), Expect = 3e-19 Identities = 47/72 (65%), Positives = 55/72 (76%) Frame = +1 Query: 292 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 471 R ++++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 126 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 185 Query: 472 RYYRLNDLVRSS 507 RYYRLN LVR S Sbjct: 186 RYYRLNGLVRPS 197 >SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 92.7 bits (220), Expect = 4e-19 Identities = 47/72 (65%), Positives = 54/72 (75%) Frame = +1 Query: 292 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 471 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 165 RKVTRKATCARCFAGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 224 Query: 472 RYYRLNDLVRSS 507 RYYRLN LVR S Sbjct: 225 RYYRLNGLVRPS 236 >SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 92.7 bits (220), Expect = 4e-19 Identities = 47/72 (65%), Positives = 54/72 (75%) Frame = +1 Query: 292 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 471 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 73 RKVTRKATCARCFAGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 132 Query: 472 RYYRLNDLVRSS 507 RYYRLN LVR S Sbjct: 133 RYYRLNGLVRPS 144 >SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 92.3 bits (219), Expect = 5e-19 Identities = 47/72 (65%), Positives = 54/72 (75%) Frame = +1 Query: 292 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 471 R ++++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTAR Sbjct: 121 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTAR 180 Query: 472 RYYRLNDLVRSS 507 RYYRLN LVR S Sbjct: 181 RYYRLNGLVRPS 192 >SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 137 Score = 91.9 bits (218), Expect = 7e-19 Identities = 47/72 (65%), Positives = 54/72 (75%) Frame = +1 Query: 292 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 471 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 47 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 106 Query: 472 RYYRLNDLVRSS 507 RYYRLN LVR S Sbjct: 107 RYYRLNGLVRPS 118 >SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 91.1 bits (216), Expect = 1e-18 Identities = 47/72 (65%), Positives = 53/72 (73%) Frame = +1 Query: 292 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 471 R +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTAR Sbjct: 126 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTAR 185 Query: 472 RYYRLNDLVRSS 507 RYYRLN LVR S Sbjct: 186 RYYRLNGLVRPS 197 >SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 91.1 bits (216), Expect = 1e-18 Identities = 47/72 (65%), Positives = 53/72 (73%) Frame = +1 Query: 292 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 471 R +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTAR Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTAR 132 Query: 472 RYYRLNDLVRSS 507 RYYRLN LVR S Sbjct: 133 RYYRLNGLVRPS 144 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 91.1 bits (216), Expect = 1e-18 Identities = 46/60 (76%), Positives = 49/60 (81%) Frame = +1 Query: 328 PRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 P+G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 102 PQGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPS 161 >SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 91.1 bits (216), Expect = 1e-18 Identities = 47/72 (65%), Positives = 53/72 (73%) Frame = +1 Query: 292 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 471 R +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTAR Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTAR 132 Query: 472 RYYRLNDLVRSS 507 RYYRLN LVR S Sbjct: 133 RYYRLNGLVRPS 144 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 90.6 bits (215), Expect = 2e-18 Identities = 45/60 (75%), Positives = 50/60 (83%) Frame = +1 Query: 328 PRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 P+G GN +K RAGD LQL +NEEFLVSA+H+LALITSLPFVHTARRYYRLN LVR S Sbjct: 42 PQGVGNLVKHRRAGDRSLQLLILNEEFLVSANHQLALITSLPFVHTARRYYRLNGLVRPS 101 >SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 89.4 bits (212), Expect = 4e-18 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = +1 Query: 331 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 21 KGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPS 79 Score = 29.1 bits (62), Expect = 5.5 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +3 Query: 276 CPGPHARYTEGIS 314 C GPHARYT+G++ Sbjct: 2 CSGPHARYTDGVN 14 >SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 89.4 bits (212), Expect = 4e-18 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = +1 Query: 331 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 21 KGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPS 79 Score = 29.1 bits (62), Expect = 5.5 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +3 Query: 276 CPGPHARYTEGIS 314 C GPHARYT+G++ Sbjct: 2 CSGPHARYTDGVN 14 >SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 89.0 bits (211), Expect = 5e-18 Identities = 46/72 (63%), Positives = 53/72 (73%) Frame = +1 Query: 292 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 471 R +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 132 Query: 472 RYYRLNDLVRSS 507 YYRLN LVR S Sbjct: 133 GYYRLNGLVRPS 144 >SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 88.6 bits (210), Expect = 6e-18 Identities = 46/72 (63%), Positives = 53/72 (73%) Frame = +1 Query: 292 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 471 R +++ C+ G GN +K RA D LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRARDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 132 Query: 472 RYYRLNDLVRSS 507 RYYRLN LVR S Sbjct: 133 RYYRLNGLVRPS 144 >SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 87.8 bits (208), Expect = 1e-17 Identities = 45/58 (77%), Positives = 47/58 (81%) Frame = +1 Query: 334 GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 22 GVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPS 79 Score = 29.1 bits (62), Expect = 5.5 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +3 Query: 276 CPGPHARYTEGIS 314 C GPHARYT+G++ Sbjct: 2 CSGPHARYTDGVN 14 >SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 86.2 bits (204), Expect = 3e-17 Identities = 44/56 (78%), Positives = 46/56 (82%) Frame = +1 Query: 340 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 3 GNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPS 58 >SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 86.2 bits (204), Expect = 3e-17 Identities = 44/56 (78%), Positives = 46/56 (82%) Frame = +1 Query: 340 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 3 GNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPS 58 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 116 DWENPGVTQLNRLAAHPPFASWRNSEE 142 >SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) Length = 186 Score = 85.8 bits (203), Expect = 4e-17 Identities = 43/56 (76%), Positives = 47/56 (83%) Frame = +1 Query: 340 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN L+R S Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLLRPS 58 >SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) Length = 214 Score = 85.4 bits (202), Expect = 6e-17 Identities = 44/58 (75%), Positives = 47/58 (81%) Frame = +1 Query: 334 GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 G GN +K RA D LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 138 GVGNLVKHRRARDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPS 195 >SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 84.6 bits (200), Expect = 1e-16 Identities = 43/56 (76%), Positives = 46/56 (82%) Frame = +1 Query: 340 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN LV S Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVTPS 58 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 83.8 bits (198), Expect = 2e-16 Identities = 46/67 (68%), Positives = 50/67 (74%), Gaps = 1/67 (1%) Frame = +1 Query: 361 RAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSADTRWL-HGRR 537 RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR S R +G Sbjct: 85 RAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSDWRRGPGNGAT 144 Query: 538 RCWEVDQ 558 C +V Q Sbjct: 145 NCRKVGQ 151 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 55 VTPGFSQSRRCKTTAS 70 >SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) Length = 101 Score = 82.2 bits (194), Expect = 6e-16 Identities = 41/52 (78%), Positives = 44/52 (84%) Frame = +1 Query: 340 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDL 495 GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN L Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGL 54 >SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 74.9 bits (176), Expect = 8e-14 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = +1 Query: 379 LQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 30 LQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPS 72 >SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) Length = 91 Score = 74.9 bits (176), Expect = 8e-14 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = +1 Query: 379 LQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 30 LQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPS 72 >SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 72.5 bits (170), Expect = 4e-13 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 394 INEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 7 LNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPS 44 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 72.5 bits (170), Expect = 4e-13 Identities = 32/46 (69%), Positives = 33/46 (71%) Frame = -1 Query: 776 FAYYPVAKRGXXAKAINLG*RQVFPIHXVVKRRPVNCNTTHYRANW 639 FA P +RG KAI LG VFP H VVKRRPVNCNTTHYRANW Sbjct: 8 FAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 72.5 bits (170), Expect = 4e-13 Identities = 32/46 (69%), Positives = 33/46 (71%) Frame = -1 Query: 776 FAYYPVAKRGXXAKAINLG*RQVFPIHXVVKRRPVNCNTTHYRANW 639 FA P +RG KAI LG VFP H VVKRRPVNCNTTHYRANW Sbjct: 22 FAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 71.7 bits (168), Expect = 8e-13 Identities = 34/55 (61%), Positives = 36/55 (65%) Frame = -1 Query: 803 GKGQSXRAFFAYYPVAKRGXXAKAINLG*RQVFPIHXVVKRRPVNCNTTHYRANW 639 GKG FA P +RG KAI LG + FP H VVKRRPVNCNTTHYRANW Sbjct: 6 GKGDRC-GLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 68.9 bits (161), Expect = 6e-12 Identities = 30/46 (65%), Positives = 32/46 (69%) Frame = -1 Query: 776 FAYYPVAKRGXXAKAINLG*RQVFPIHXVVKRRPVNCNTTHYRANW 639 FA P +RG K+I L VFP H VVKRRPVNCNTTHYRANW Sbjct: 16 FAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 65.7 bits (153), Expect = 5e-11 Identities = 31/46 (67%), Positives = 32/46 (69%) Frame = -1 Query: 776 FAYYPVAKRGXXAKAINLG*RQVFPIHXVVKRRPVNCNTTHYRANW 639 FA P +RG KAI L VFP H VVKRRPVNCNTTHYRANW Sbjct: 1855 FAITPAGERGMCCKAIKLV-TPVFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 64.1 bits (149), Expect = 2e-10 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = -1 Query: 776 FAYYPVAKRGXXAKA-INLG*RQVFPIHXVVKRRPVNCNTTHYRANW 639 FA P ++G + + LG RQ FP H VVKRRPVNCNTTHYRANW Sbjct: 56 FAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -3 Query: 798 RPIXAGLFRLLPXCQKGXXCKGD-*FGLTPGFPN 700 R I AGLF + P +KG +GD G GFP+ Sbjct: 49 RAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPS 82 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 61.7 bits (143), Expect = 8e-10 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = +3 Query: 642 IRPIVSRITIHWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 IRPIVSRITIHWPSFY +WEN + Q+NRL PF + SE+ Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEE 63 >SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 40 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 71 >SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 61.3 bits (142), Expect = 1e-09 Identities = 30/54 (55%), Positives = 36/54 (66%) Frame = -1 Query: 800 KGQSXRAFFAYYPVAKRGXXAKAINLG*RQVFPIHXVVKRRPVNCNTTHYRANW 639 +G+S RA +AK G A+ ++ G FP H VVKRRPVNCNTTHYRANW Sbjct: 599 EGRSVRASSLLRQLAKGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 648 >SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 167 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 15 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 46 >SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 61.3 bits (142), Expect = 1e-09 Identities = 30/54 (55%), Positives = 36/54 (66%) Frame = -1 Query: 800 KGQSXRAFFAYYPVAKRGXXAKAINLG*RQVFPIHXVVKRRPVNCNTTHYRANW 639 +G+S RA +AK G A+ ++ G FP H VVKRRPVNCNTTHYRANW Sbjct: 42 EGRSVRASSLLRQLAKGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 91 >SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 61.3 bits (142), Expect = 1e-09 Identities = 30/54 (55%), Positives = 36/54 (66%) Frame = -1 Query: 800 KGQSXRAFFAYYPVAKRGXXAKAINLG*RQVFPIHXVVKRRPVNCNTTHYRANW 639 +G+S RA +AK G A+ ++ G FP H VVKRRPVNCNTTHYRANW Sbjct: 42 EGRSVRASSLLRQLAKGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 91 >SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 92 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 123 >SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.3 bits (142), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 412 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 507 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 45 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 60.9 bits (141), Expect = 1e-09 Identities = 31/53 (58%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = -1 Query: 797 GQSXRA-FFAYYPVAKRGXXAKAINLG*RQVFPIHXVVKRRPVNCNTTHYRAN 642 G+S A FA P +RG KAI LG + FP H KRRPVNCNTTHYRAN Sbjct: 45 GRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -3 Query: 798 RPIXAGLFRLLPXCQKGXXCKGD*FGLTPGFPN 700 R I AGLF + P ++G CK G GFP+ Sbjct: 46 RSIGAGLFAITPAGERGMCCKAIKLGNARGFPS 78 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 60.9 bits (141), Expect = 1e-09 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -1 Query: 761 VAKRGXXAKAINLG*RQVFPIHXVVKRRPVNCNTTHYRAN 642 +A+RG KAI LG VF H VVKRRPVNCNTTHYRAN Sbjct: 1 LAERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 60.5 bits (140), Expect = 2e-09 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +3 Query: 639 PIRPIVSRITIHWPSFYNXVNWENLALTQINRLCXXSPFGN 761 PIRPIVSRITIHWP+FYN + LA TQ+NRL PF + Sbjct: 39 PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFAS 79 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 58.8 bits (136), Expect = 6e-09 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +3 Query: 657 SRITIHWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 SRITIHWPSFYN V+WEN +TQ+NRL PF + SE+ Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSEE 42 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 58.0 bits (134), Expect = 1e-08 Identities = 29/54 (53%), Positives = 35/54 (64%) Frame = -1 Query: 800 KGQSXRAFFAYYPVAKRGXXAKAINLG*RQVFPIHXVVKRRPVNCNTTHYRANW 639 +G+S RA +AK G A+ ++ FP H VVKRRPVNCNTTHYRANW Sbjct: 28 EGRSVRASSLLRQLAKGGCAARRLSWV-TPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 55.6 bits (128), Expect = 5e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 710 VFPIHXVVKRRPVNCNTTHYRANW 639 VFP H VVKRRPVNCNTTHYRANW Sbjct: 36 VFPSHDVVKRRPVNCNTTHYRANW 59 >SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 55.2 bits (127), Expect = 7e-08 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = -2 Query: 508 PKTSLNHSIGSSDGRCVQRAGT*STRAYDSRLLGIPR 398 P S +HSIGSSDGRCVQRAGT S D RLLGIPR Sbjct: 31 PLNSPSHSIGSSDGRCVQRAGTQSMHIDDMRLLGIPR 67 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 54.8 bits (126), Expect = 1e-07 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -1 Query: 716 RQVFPIHXVVKRRPVNCNTTHYRANW 639 R FP H VVKRRPVNCNTTHYRANW Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 54.0 bits (124), Expect = 2e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 707 FPIHXVVKRRPVNCNTTHYRANW 639 FP H VVKRRPVNCNTTHYRANW Sbjct: 2 FPSHDVVKRRPVNCNTTHYRANW 24 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +3 Query: 657 SRITIHWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 SRITIHWPSFYN V + L++TQ+NRL PF + SE+ Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEE 42 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = +3 Query: 657 SRITIHWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 SRITIHWPSFYN V +N +TQ+NRL PF + SE+ Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEE 42 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = +3 Query: 657 SRITIHWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 SRITIHWPSFYN V +N +TQ+NRL PF + SE+ Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEE 42 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = +3 Query: 657 SRITIHWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 SRITIHWPSFYN V +N +TQ+NRL PF + SE+ Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEE 42 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 49.6 bits (113), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 698 HXVVKRRPVNCNTTHYRANW 639 H VVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 49.6 bits (113), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 698 HXVVKRRPVNCNTTHYRANW 639 H VVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/42 (50%), Positives = 27/42 (64%) Frame = +3 Query: 654 VSRITIHWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 +SRITIHWPS +WEN +TQ+NRL PF + SE+ Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 318 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/41 (53%), Positives = 27/41 (65%) Frame = +3 Query: 657 SRITIHWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 SRITIHWPSFYN + + +TQ+NRL PF + SEK Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEK 42 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 639 PIRPIVSRITIHWPSFYNXV 698 PIRPIVS ITIHWPSFYN V Sbjct: 41 PIRPIVSHITIHWPSFYNGV 60 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/41 (51%), Positives = 25/41 (60%) Frame = +3 Query: 657 SRITIHWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 SRITIHWPSFYN V + LAL + L PF + SE+ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEE 42 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/48 (52%), Positives = 31/48 (64%), Gaps = 2/48 (4%) Frame = +3 Query: 642 IRPIVSRITIHWPSFYNXVNWENLALTQINRL--CXXSPFGNXVISEK 779 +RP+VSRITIHW SFYN V + LAL + L SP G VI+E+ Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAG--VIAEE 78 >SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 505 KTSLNHSIGSSDGRCVQRAG 446 K SLNHSIGSSDGRCVQRAG Sbjct: 23 KASLNHSIGSSDGRCVQRAG 42 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 83 DWENPGVTQLNRLAAHPPFASWRNSEE 109 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = +3 Query: 672 HWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 HWPSFYN V + L +TQ+NRL PF + SE+ Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEE 40 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/41 (51%), Positives = 25/41 (60%) Frame = +3 Query: 657 SRITIHWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 SRITIHWPSFYN V + LAL + L PF + SE+ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEE 42 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/41 (51%), Positives = 25/41 (60%) Frame = +3 Query: 657 SRITIHWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 SRITIHWPSFYN V + LAL + L PF + SE+ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEE 42 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 41.9 bits (94), Expect = 7e-04 Identities = 24/55 (43%), Positives = 28/55 (50%) Frame = +3 Query: 657 SRITIHWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEKGPXRLAFXKXLXXL 821 SRITIHWPSFYN V + LAL + L P + K P +A K L L Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGVIAKRPAPIALPKQLRSL 55 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = +3 Query: 648 PIVSRITIHWPSFYNXVNWENLALTQI 728 P +SRITIHWPSFYN V + LAL + Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNL 103 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/35 (54%), Positives = 20/35 (57%) Frame = -2 Query: 805 LXKANRCGPFSLITXLPKGDXLQRRLIWVNARFSQ 701 L K +RCGP KGD LQRRL WV FSQ Sbjct: 5 LGKGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQ 39 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 33 VTPGFSQSRRCKTTASEL 50 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/40 (55%), Positives = 26/40 (65%) Frame = -2 Query: 430 AYDSRLLGIPRLWGIIANPNPQHEGVSAGCPGL*ARENML 311 A DSRLLGIPR IIA PQH+ VS P L A+E ++ Sbjct: 85 ADDSRLLGIPRSRSIIAMIYPQHDDVSQDYPRLPAKERLV 124 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 55 VTPGFSQSRRCKTTAS 70 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/41 (46%), Positives = 24/41 (58%) Frame = +3 Query: 657 SRITIHWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 SRITIHWPSFYN V + LAL + L + + SE+ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEE 42 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = +3 Query: 657 SRITIHWPSFYNXVNWENLALTQI 728 SRITIHWPSFYN V + LAL + Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNL 25 >SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) Length = 282 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +3 Query: 675 WPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 WPS YN +W N +TQ+NRL PF + SE+ Sbjct: 218 WPSIYNDRDWNNSGVTQLNRLVAHLPFVSWRNSEE 252 >SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 311 DSFSVARVRPRTSKGITDL 255 D+ SVARVRPRTSKGITDL Sbjct: 34 DTVSVARVRPRTSKGITDL 52 >SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 311 DSFSVARVRPRTSKGITDL 255 D+ SVARVRPRTSKGITDL Sbjct: 132 DTVSVARVRPRTSKGITDL 150 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 505 KTSLNHSIGSSDGRCV 458 K S+NHSIGSSDGR + Sbjct: 91 KASVNHSIGSSDGRSI 106 >SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 311 DSFSVARVRPRTSKGITDL 255 D+ SVARVRPRTSKGITDL Sbjct: 64 DTVSVARVRPRTSKGITDL 82 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 505 KTSLNHSIGSSDGRCV 458 K SLNHSIGSSDGR + Sbjct: 23 KASLNHSIGSSDGRSI 38 >SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 311 DSFSVARVRPRTSKGITDL 255 D+ SVARVRPRTSKGITDL Sbjct: 64 DTVSVARVRPRTSKGITDL 82 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 505 KTSLNHSIGSSDGRCV 458 K SLNHSIGSSDGR + Sbjct: 23 KASLNHSIGSSDGRSI 38 >SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 311 DSFSVARVRPRTSKGITDL 255 D+ SVARVRPRTSKGITDL Sbjct: 64 DTVSVARVRPRTSKGITDL 82 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 505 KTSLNHSIGSSDGRCV 458 K SLNHSIGSSDGR + Sbjct: 23 KASLNHSIGSSDGRSI 38 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -2 Query: 799 KANRCGPFSLITXLPKGDXLQRRLIWVNARFSQ 701 K +RCGP KGD LQ RL WV FSQ Sbjct: 7 KGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQ 39 Score = 36.7 bits (81), Expect = 0.027 Identities = 19/39 (48%), Positives = 22/39 (56%) Frame = -3 Query: 783 GLFRLLPXCQKGXXCKGD*FGLTPGFPNSRXCKTTASEL 667 G R +KG +G +TPGF SR CKTTASEL Sbjct: 12 GPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 35.9 bits (79), Expect = 0.047 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = -3 Query: 783 GLFRLLPXCQKGXXCKGD*FGLTPGFPNSRXCKTTASEL 667 G R +KG G TPGF SR CKTTASEL Sbjct: 41 GPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 35.9 bits (79), Expect = 0.047 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +3 Query: 657 SRITIHWPSFYNXVNWEN 710 SRITIHWPSFYN V +N Sbjct: 2 SRITIHWPSFYNVVTGKN 19 >SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) Length = 86 Score = 35.5 bits (78), Expect = 0.063 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 311 DSFSVARVRPRTSKGITDL 255 D+ SVA VRPRTSKGITDL Sbjct: 64 DTVSVAHVRPRTSKGITDL 82 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 505 KTSLNHSIGSSDGRCV 458 K SLNHSIGSSDGR + Sbjct: 23 KASLNHSIGSSDGRSI 38 >SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -1 Query: 740 AKAINLG*RQVFPIHXVVKRRPV 672 +KAI LG VFP H VVKRRPV Sbjct: 3 SKAIKLGNASVFPSHDVVKRRPV 25 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 737 KAINLG*RQVFPIHXVVKRRPV 672 KAI LG +VFP H VVKRRPV Sbjct: 4 KAIKLGNARVFPSHDVVKRRPV 25 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 33.9 bits (74), Expect = 0.19 Identities = 23/55 (41%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -3 Query: 828 PIXGXAXXWX-RPIXAGLFRLLPXCQKGXXCKGD*FGLTPGFPNSRXCKTTASEL 667 P G W R + A LL KG +TPGF SR CKTTASEL Sbjct: 354 PYSGLRNCWEGRSVRAS--SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 40 VTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 252 VTPGFSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 920 VTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 33 VTPGFSQSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 32 VTPGFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 407 VTPGFSQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 256 VTPGFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 323 VTPGFSQSRRCKTTASEL 340 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 81 VTPGFSQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 40 VTPGFSQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 33 VTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 33 VTPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 40 VTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 40 VTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 63 VTPGFSQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 299 VTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 283 VTPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 33 VTPGFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 272 VTPGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 297 VTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 481 VTPGFSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 150 VTPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 316 VTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 166 VTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 40 VTPGFSQSRRCKTTASEL 57 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 359 VTPGFSQSRRCKTTASEL 376 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 40 VTPGFSQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 26 VTPGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 225 VTPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 617 VTPGFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 253 VTPGFSQSRRCKTTASEL 270 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 93 VTPGFSQSRRCKTTASEL 110 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 Query: 799 KANRCGPFSLITXLPKGDXLQRRLIWVNARFSQ 701 + +RCGP KG RRL WV FSQ Sbjct: 67 QGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQ 99 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 531 VTPGFSQSRRCKTTASEL 548 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 114 VTPGFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 422 VTPGFSQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 26 VTPGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL 667 +TPGF SR CKTTASEL Sbjct: 215 VTPGFSQSRRCKTTASEL 232 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 33.1 bits (72), Expect = 0.33 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 7/44 (15%) Frame = +3 Query: 669 IHWPSFYNXV-------NWENLALTQINRLCXXSPFGNXVISEK 779 IH+ S+YN + +WEN +TQ+NRL PF + SE+ Sbjct: 1464 IHYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 1507 >SB_13868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 33.1 bits (72), Expect = 0.33 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -1 Query: 608 PYGKXCYDFYFL*MIKF 558 PY CYDFYFL MIKF Sbjct: 8 PYENPCYDFYFLKMIKF 24 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDG 467 K SLNHSIGSSDG Sbjct: 43 KASLNHSIGSSDG 55 >SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 311 DSFSVARVRPRTSKGITDL 255 D+ SVARVR +TSKGITDL Sbjct: 64 DTVSVARVRAKTSKGITDL 82 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 505 KTSLNHSIGSSDGRCV 458 K SLNHSIGSSDGR + Sbjct: 23 KASLNHSIGSSDGRSI 38 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 32.7 bits (71), Expect = 0.44 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASEL*YDSL 652 +TPGF SR CKTTASE D L Sbjct: 40 VTPGFSQSRRCKTTASEFPGDPL 62 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 93 DWENPGVTQLNRLAAHPPFASWRNSEE 119 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 32.7 bits (71), Expect = 0.44 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 7/51 (13%) Frame = +3 Query: 648 PIVSRITIHWPSFYNXV-------NWENLALTQINRLCXXSPFGNXVISEK 779 P V + + H S+YN + +WEN +TQ+NRL PF + SE+ Sbjct: 46 PFVPKSSRHSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 96 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -1 Query: 800 KGQSXRAFFAYYPVAKRGXXAKAINLG*RQVFPIHXVVKRRPV 672 +G+S RA +AK G A+ ++ G FP H VVKRRPV Sbjct: 29 EGRSVRASSLLRQLAKGGCAARRLSWG----FPSHDVVKRRPV 67 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 31.9 bits (69), Expect = 0.77 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 720 LTPGFPNSRXCKTTASE 670 +TPGF SR CKTTASE Sbjct: 562 VTPGFSQSRRCKTTASE 578 >SB_49320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 505 KTSLNHSIGSSDGRCV 458 K SLNHSIGSSDGR + Sbjct: 23 KASLNHSIGSSDGRSI 38 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +3 Query: 654 VSRITIHWPSFYNXVNWENLALTQINRLCXXSPFGNXVISEK 779 +SRIT +WEN +TQ+NRL PF + SE+ Sbjct: 88 LSRITNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEE 129 >SB_20754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEKG 782 +WEN +TQ+NRL PF + SE+G Sbjct: 16 DWENPGVTQLNRLGAHPPFARWLNSEEG 43 >SB_45504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEKGPXRLAF 800 +WEN +TQ+NRL PF + SE+ P R F Sbjct: 352 DWENPGVTQLNRLAAHPPFASWRNSER-PHRSPF 384 >SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_28934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_26329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SEK Sbjct: 131 DWENPGVTQLNRLAAHPPFASWRNSEK 157 >SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_12244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_9373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_7163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_56749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 72 DWENPGVTQLNRLAAHPPFASWRNSEE 98 >SB_55659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SEK Sbjct: 66 DWENPGVTQLNRLAAHPPFASWRNSEK 92 >SB_45187| Best HMM Match : Sulfolobus_pRN (HMM E-Value=0.95) Length = 108 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SEK Sbjct: 139 DWENPGVTQLNRLAAHPPFASWGNSEK 165 >SB_9584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_3231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDGR 464 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_57049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 599 KXCYDFYFL*MIKF 558 K CYDFYFL MIKF Sbjct: 5 KPCYDFYFLYMIKF 18 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 505 KTSLNHSIGSSDG 467 K SLNHSIGSSDG Sbjct: 37 KASLNHSIGSSDG 49 >SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 265 MPLDVLGRTRATLKES 312 MPLDVLGRTRATL S Sbjct: 1 MPLDVLGRTRATLTVS 16 >SB_46414| Best HMM Match : Extensin_2 (HMM E-Value=0.31) Length = 469 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 683 VLQXRELGKPGVNPN*SPLQXIPFWQ 760 VL E+ PG+ P +P+Q +PFW+ Sbjct: 156 VLPILEIHSPGITPLGNPVQVLPFWK 181 >SB_33025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +1 Query: 673 TGRRFTTS*IGKTWR*P 723 TGRRFTT+ +GK WR P Sbjct: 96 TGRRFTTTGLGKPWRYP 112 >SB_25902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 16 DWENTGVTQLNRLAAHPPFASWRSSEE 42 >SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +1 Query: 670 FTGRRFTTS*IGKTWR*PKLIAFAXXPLLAT 762 +TGRRFTT GKT P LIA P A+ Sbjct: 54 WTGRRFTTLVTGKTLALPNLIALQHIPHFAS 84 >SB_7045| Best HMM Match : rve (HMM E-Value=3.8e-22) Length = 1213 Score = 30.3 bits (65), Expect = 2.4 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = -1 Query: 686 KRRPVNCNTTHYRANWVTGPPPFRRFPYGKXCYD 585 ++ +N + ++ R++W PPPF F + C++ Sbjct: 31 EKNGLNSSASNGRSSWSEAPPPFAAFCFADECFE 64 >SB_3997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 16 DWENTGVTQLNRLAAHPPFASWRSSEE 42 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 508 VTPGFSQSRRCKTTAS 523 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 50 DWENTGVTQLNRLAAHPPFASWRNSEE 76 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 55 VTPGFSQSRRCKTTAS 70 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 178 VTPGFSQSRRCKTTAS 193 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 37 DWENTGVTQLNRLAAHPPFASWRNSEE 63 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 43 DWENTGVTQLNRLAAHPPFASWRNSEE 69 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 255 VTPGFSQSRRCKTTAS 270 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 37 DWENTGVTQLNRLAAHPPFASWRNSEE 63 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 399 VTPGFSQSRRCKTTAS 414 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 55 VTPGFSQSRRCKTTAS 70 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 37 DWENTGVTQLNRLAAHPPFASWRNSEE 63 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 62 DWENTGVTQLNRLAAHPPFASWRNSEE 88 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 101 VTPGFSQSRRCKTTAS 116 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) Length = 146 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 64 DWENTGVTQLNRLAVHPPFASWRNSEE 90 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 55 VTPGFSQSRRCKTTAS 70 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 37 DWENTGVTQLNRLAAHPPFASWRNSEE 63 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 98 DWENTGVTQLNRLAAHPPFASWRNSEE 124 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 682 VTPGFSQSRRCKTTAS 697 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 37 DWENTGVTQLNRLAAHPPFASWRNSEE 63 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 50 DWENTGVTQLNRLAAHPPFASWRNSEE 76 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 59 DWENTGVTQLNRLAAHPPFASWRNSEE 85 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 60 DWENTGVTQLNRLAAHPPFASWRNSEE 86 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 188 VTPGFSQSRRCKTTAS 203 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 55 VTPGFSQSRRCKTTAS 70 >SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 37 DWENTGVTQLNRLAAHPPFASWRNSEE 63 >SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) Length = 241 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 159 DWENTGVTQLNRLAAHPPFASWRNSEE 185 >SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 36 DWENTGVTQLNRLAAHPPFASWRNSEE 62 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 16 DWENTGVTQLNRLAAHPPFASWRNSEE 42 >SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 37 DWENTGVTQLNRLAAHPPFASWRNSEE 63 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 37 DWENTGVTQLNRLAAHPPFASWRNSEE 63 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 65 DWENTGVTQLNRLAAHPPFASWRNSEE 91 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 699 NWENLALTQINRLCXXSPFGNXVISEK 779 +WEN +TQ+NRL PF + SE+ Sbjct: 54 DWENTGVTQLNRLAAHPPFASWRNSEE 80 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 720 LTPGFPNSRXCKTTAS 673 +TPGF SR CKTTAS Sbjct: 33 VTPGFSQSRRCKTTAS 48 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,257,070 Number of Sequences: 59808 Number of extensions: 582897 Number of successful extensions: 7034 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7013 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2752873431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -