BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0349.Seq (444 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9VZS3 Cluster: Protein translation factor SUI1 homolog... 59 5e-08 UniRef50_O60739 Cluster: Eukaryotic translation initiation facto... 48 9e-05 UniRef50_P41567 Cluster: Eukaryotic translation initiation facto... 46 3e-04 UniRef50_UPI0000DD7914 Cluster: PREDICTED: similar to suppressor... 39 0.042 UniRef50_Q94JV4 Cluster: Protein translation factor SUI1 homolog... 39 0.042 UniRef50_Q7XN79 Cluster: OSJNBa0089N06.3 protein; n=6; Oryza sat... 35 0.69 UniRef50_Q00RG6 Cluster: H0303G06.6 protein; n=2; Oryza sativa|R... 35 0.69 UniRef50_Q54CC3 Cluster: Putative uncharacterized protein; n=1; ... 33 2.1 UniRef50_O74516 Cluster: Putative methyltransferase UPF0383; n=1... 32 6.4 UniRef50_Q4SP28 Cluster: Chromosome 15 SCAF14542, whole genome s... 31 8.5 >UniRef50_Q9VZS3 Cluster: Protein translation factor SUI1 homolog; n=11; Bilateria|Rep: Protein translation factor SUI1 homolog - Drosophila melanogaster (Fruit fly) Length = 110 Score = 58.8 bits (136), Expect = 5e-08 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +2 Query: 2 GDQRENICQWLTKSGLVKPEQLKVHGF 82 GDQRENICQWLTK GL KP+QLKVHGF Sbjct: 84 GDQRENICQWLTKVGLAKPDQLKVHGF 110 >UniRef50_O60739 Cluster: Eukaryotic translation initiation factor 1b; n=44; Fungi/Metazoa group|Rep: Eukaryotic translation initiation factor 1b - Homo sapiens (Human) Length = 113 Score = 48.0 bits (109), Expect = 9e-05 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = +2 Query: 2 GDQRENICQWLTKSGLVKPEQLKVHGF 82 GDQR+NICQ+L + G+VK EQLKVHGF Sbjct: 87 GDQRKNICQFLLEVGIVKEEQLKVHGF 113 >UniRef50_P41567 Cluster: Eukaryotic translation initiation factor 1; n=53; Eukaryota|Rep: Eukaryotic translation initiation factor 1 - Homo sapiens (Human) Length = 113 Score = 46.4 bits (105), Expect = 3e-04 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = +2 Query: 2 GDQRENICQWLTKSGLVKPEQLKVHGF 82 GDQR+NICQ+L + GL K +QLKVHGF Sbjct: 87 GDQRKNICQFLVEIGLAKDDQLKVHGF 113 >UniRef50_UPI0000DD7914 Cluster: PREDICTED: similar to suppressor of initiator codon mutations, related sequence 1; n=1; Homo sapiens|Rep: PREDICTED: similar to suppressor of initiator codon mutations, related sequence 1 - Homo sapiens Length = 288 Score = 39.1 bits (87), Expect = 0.042 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = +2 Query: 2 GDQRENICQWLTKSGLVKPEQLKVHGF 82 GDQ NICQ+L + GL K +QLKVH F Sbjct: 262 GDQCNNICQFLVELGLAKDDQLKVHVF 288 >UniRef50_Q94JV4 Cluster: Protein translation factor SUI1 homolog 2; n=42; Eukaryota|Rep: Protein translation factor SUI1 homolog 2 - Arabidopsis thaliana (Mouse-ear cress) Length = 113 Score = 39.1 bits (87), Expect = 0.042 Identities = 14/27 (51%), Positives = 22/27 (81%) Frame = +2 Query: 2 GDQRENICQWLTKSGLVKPEQLKVHGF 82 GDQR+N+ +L ++GLVK + +K+HGF Sbjct: 87 GDQRKNVSTFLVQAGLVKKDNIKIHGF 113 >UniRef50_Q7XN79 Cluster: OSJNBa0089N06.3 protein; n=6; Oryza sativa|Rep: OSJNBa0089N06.3 protein - Oryza sativa (Rice) Length = 580 Score = 35.1 bits (77), Expect = 0.69 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +2 Query: 2 GDQRENICQWLTKSGLVKPEQLKVHGF 82 GD R ++ +L K+G+V+ + +KVHGF Sbjct: 554 GDHRNSVSDFLAKAGMVRKDNIKVHGF 580 >UniRef50_Q00RG6 Cluster: H0303G06.6 protein; n=2; Oryza sativa|Rep: H0303G06.6 protein - Oryza sativa (Rice) Length = 241 Score = 35.1 bits (77), Expect = 0.69 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +2 Query: 2 GDQRENICQWLTKSGLVKPEQLKVHGF 82 GD R ++ +L K+G+V+ + +KVHGF Sbjct: 215 GDHRNSVSDFLAKAGMVRKDNIKVHGF 241 >UniRef50_Q54CC3 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 702 Score = 33.5 bits (73), Expect = 2.1 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +2 Query: 314 QSNEIVNIPNSLFLFLYDIVFLNCCNNSI 400 QSN++ +IPNS+ L +++ +NC NN + Sbjct: 503 QSNQLTSIPNSIGLNCVNLISINCSNNQL 531 >UniRef50_O74516 Cluster: Putative methyltransferase UPF0383; n=1; Schizosaccharomyces pombe|Rep: Putative methyltransferase UPF0383 - Schizosaccharomyces pombe (Fission yeast) Length = 502 Score = 31.9 bits (69), Expect = 6.4 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = +3 Query: 162 IKNMYLESTDVYREKRTRLSAPCALRLPLLYKYCKSYILSPPSRLISCKIINRTK 326 ++ +YL D RE +RL + L +L+K+CK + R++ ++ R K Sbjct: 169 VEVLYLVEKDFQRELSSRLLRTAHMLLLVLHKHCKGAVEGYQKRMLHDTVVERNK 223 >UniRef50_Q4SP28 Cluster: Chromosome 15 SCAF14542, whole genome shotgun sequence; n=8; Clupeocephala|Rep: Chromosome 15 SCAF14542, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 227 Score = 31.5 bits (68), Expect = 8.5 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 317 SNEIVNIPNSLFLFLYDIVFLNCCNNSINK 406 +N IV +P +L D+V+L+C NNS+ + Sbjct: 71 NNRIVELPPLALNYLSDLVYLDCSNNSLTE 100 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 403,658,127 Number of Sequences: 1657284 Number of extensions: 7247673 Number of successful extensions: 15513 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 15079 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15505 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 22761518346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -