BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0344.Seq (856 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 3e-12 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 64 1e-10 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 59 4e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 9e-09 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 5e-08 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 5e-08 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-08 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-08 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 54 2e-07 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 54 2e-07 SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 8e-07 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 49 4e-06 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_20754| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 49 4e-06 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 6e-06 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 6e-06 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 49 6e-06 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 6e-06 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 48 7e-06 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 48 1e-05 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 47 2e-05 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 47 2e-05 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 47 2e-05 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 47 2e-05 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 47 2e-05 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 47 2e-05 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 47 2e-05 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 47 2e-05 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 47 2e-05 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 47 2e-05 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 47 2e-05 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 47 2e-05 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 47 2e-05 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 47 2e-05 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 47 2e-05 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_15928| Best HMM Match : BA14K (HMM E-Value=7) 47 2e-05 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_19937| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 46 5e-05 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 46 5e-05 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 46 5e-05 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 46 5e-05 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 46 5e-05 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 46 5e-05 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 46 5e-05 SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) 46 5e-05 SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_14731| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 46 5e-05 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 46 5e-05 SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_57755| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 46 5e-05 SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_54475| Best HMM Match : Adeno_VII (HMM E-Value=9.4) 46 5e-05 SB_53953| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_48979| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_42420| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_37837| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_36825| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_35598| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_34794| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_33898| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_33514| Best HMM Match : DUF503 (HMM E-Value=1.6) 46 5e-05 SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_32886| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_29948| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_29695| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_27907| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_27247| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_26184| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_25988| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_25331| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_24868| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_22584| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_21002| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_20750| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_19365| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 46 5e-05 SB_18964| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_18148| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 46 5e-05 SB_17776| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_16561| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 46 5e-05 SB_14675| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_14548| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_14046| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_13642| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_13143| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 46 5e-05 SB_12757| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_11792| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_11340| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_10857| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_10117| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_10054| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_7369| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_6429| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_5748| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_4254| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_3679| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_1518| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 45 7e-05 SB_58039| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 45 7e-05 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 45 7e-05 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 45 9e-05 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 45 9e-05 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 45 9e-05 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 45 9e-05 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 45 9e-05 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 45 9e-05 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 45 9e-05 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 45 9e-05 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 45 9e-05 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 45 9e-05 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 45 9e-05 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 45 9e-05 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 45 9e-05 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 45 9e-05 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 45 9e-05 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 45 9e-05 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 45 9e-05 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 45 9e-05 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 45 9e-05 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 45 9e-05 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 45 9e-05 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 45 9e-05 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 45 9e-05 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 45 9e-05 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 45 9e-05 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 45 9e-05 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 45 9e-05 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 45 9e-05 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 45 9e-05 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 45 9e-05 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 45 9e-05 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 45 9e-05 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = +1 Query: 568 IRPIVSRITIHWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 +RP+VSRITIHW SF GKT ALPNLIAL+HIPLSP GVI +AR D P Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRP 84 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 70.5 bits (165), Expect = 2e-12 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = +1 Query: 574 PIVSRITIHWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 P +SRITIHWPSF GKT ALPNLIAL+HIPLSP G+ +AR D P Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRP 126 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 69.7 bits (163), Expect = 3e-12 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +1 Query: 583 SRITIHWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 SRITIHWPSF GKT ALPNLIAL+HIPLSP GV + +AR D P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRP 48 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 64.5 bits (150), Expect = 1e-10 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 583 SRITIHWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXK 705 SRITIHWPSF GKT ALPNLIAL+HIPLSP GVI + Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKR 42 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 63.7 bits (148), Expect = 2e-10 Identities = 34/61 (55%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Frame = -2 Query: 744 QGXKXXERXIXAGLXRYYXXWXKGDVLQGD*-VG*RPGFSQSRRCKRRPVNCNTTHYRAN 568 Q + R I AGL KGDVLQGD +G R GF KRRPVNCNTTHYRAN Sbjct: 42 QAAQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRAN 101 Query: 567 W 565 W Sbjct: 102 W 102 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVVYNVVTGK GVTQLNRL AHPPF W N+E Sbjct: 8 LAVVYNVVTGKTPGVTQLNRLAAHPPFASWRNSE 41 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 59.3 bits (137), Expect = 4e-09 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 701 FVITPXGERGMCSKAIKLGNAQVFPSHDVV 612 F ITP GERGMC KAIKLGNA VFPSHDVV Sbjct: 8 FAITPAGERGMCCKAIKLGNASVFPSHDVV 37 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 612 KRRPVNCNTTHYRANW 565 KRRPVNCNTTHYRANW Sbjct: 38 KRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 59.3 bits (137), Expect = 4e-09 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 701 FVITPXGERGMCSKAIKLGNAQVFPSHDVV 612 F ITP GERGMC KAIKLGNA VFPSHDVV Sbjct: 22 FAITPAGERGMCCKAIKLGNASVFPSHDVV 51 Score = 45.6 bits (103), Expect = 5e-05 Identities = 25/60 (41%), Positives = 29/60 (48%) Frame = -2 Query: 744 QGXKXXERXIXAGLXRYYXXWXKGDVLQGD*VG*RPGFSQSRRCKRRPVNCNTTHYRANW 565 Q + R I AGL +G + +G F KRRPVNCNTTHYRANW Sbjct: 8 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 58.0 bits (134), Expect = 9e-09 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = +1 Query: 598 HWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 HWPSF GKT ALPNLIAL+HIPLSP G + +AR D P Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRP 46 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 57.6 bits (133), Expect = 1e-08 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 612 YNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 YNVVTGKN GVTQLNRL AHPPF W N+E Sbjct: 12 YNVVTGKNTGVTQLNRLAAHPPFASWRNSE 41 Score = 31.9 bits (69), Expect = 0.68 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = +1 Query: 583 SRITIHWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 SRITIHWPSF GK + L L P + +AR D P Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 57.6 bits (133), Expect = 1e-08 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 612 YNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 YNVVTGKN GVTQLNRL AHPPF W N+E Sbjct: 12 YNVVTGKNTGVTQLNRLAAHPPFASWRNSE 41 Score = 31.9 bits (69), Expect = 0.68 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = +1 Query: 583 SRITIHWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 SRITIHWPSF GK + L L P + +AR D P Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.2 bits (132), Expect = 2e-08 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 612 YNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 YNVVTGK LGVTQLNRL AHPPF W N+E Sbjct: 10 YNVVTGKTLGVTQLNRLAAHPPFASWRNSE 39 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 701 FVITPXGERGMCSKAIKLGNAQVFPSHDVV 612 F ITP GERGMC KAIKLGNA+ FPSHDVV Sbjct: 14 FAITPAGERGMCCKAIKLGNAKGFPSHDVV 43 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/29 (65%), Positives = 20/29 (68%) Frame = -2 Query: 651 VG*RPGFSQSRRCKRRPVNCNTTHYRANW 565 +G GF KRRPVNCNTTHYRANW Sbjct: 31 LGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 612 YNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 YNVVTGKN GVTQLNRL AHPPF W N+E Sbjct: 12 YNVVTGKNPGVTQLNRLAAHPPFASWRNSE 41 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = +1 Query: 583 SRITIHWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 SRITIHWPSF GK + L L P + +AR D P Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEARTDRP 48 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 55.6 bits (128), Expect = 5e-08 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +1 Query: 598 HWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXK 705 HWPSF GKT ALPNLIAL+HIPLSP GVI + Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKR 97 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 55.6 bits (128), Expect = 5e-08 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +1 Query: 598 HWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXK 705 HWPSF GKT ALPNLIAL+HIPLSP GVI + Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKR 92 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 55.2 bits (127), Expect = 6e-08 Identities = 28/47 (59%), Positives = 31/47 (65%) Frame = +1 Query: 583 SRITIHWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 SRITIHWPSF GKT ALPNLIAL+HIP + +AR D P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRP 48 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 54.8 bits (126), Expect = 8e-08 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +3 Query: 612 YNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 YNVVTGK L VTQLNRL AHPPF W N+E Sbjct: 12 YNVVTGKTLSVTQLNRLAAHPPFASWRNSE 41 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/47 (42%), Positives = 24/47 (51%) Frame = +1 Query: 583 SRITIHWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 SRITIHWPSF GKT ++ L L P + +AR D P Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEARTDRP 48 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 54.8 bits (126), Expect = 8e-08 Identities = 27/47 (57%), Positives = 29/47 (61%) Frame = +1 Query: 583 SRITIHWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 SRITIHWPSF GKT ALPNL L HIPL + +AR D P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRP 48 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 53.6 bits (123), Expect = 2e-07 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -3 Query: 701 FVITPXGERGMCSKAIKLGNAQVFPSHDVV 612 F ITP GERGMC K+IKL +A VFPSHDVV Sbjct: 16 FAITPAGERGMCCKSIKLAHASVFPSHDVV 45 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 612 KRRPVNCNTTHYRANW 565 KRRPVNCNTTHYRANW Sbjct: 46 KRRPVNCNTTHYRANW 61 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 53.6 bits (123), Expect = 2e-07 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = -3 Query: 701 FVITPXGERGMCSKAIKLGNAQVFPSHD 618 F ITP GERGMC KAIKLGNA+ FPSHD Sbjct: 53 FAITPAGERGMCCKAIKLGNARGFPSHD 80 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/52 (46%), Positives = 27/52 (51%) Frame = -2 Query: 723 RXIXAGLXRYYXXWXKGDVLQGD*VG*RPGFSQSRRCKRRPVNCNTTHYRAN 568 R I AGL +G + +G GF KRRPVNCNTTHYRAN Sbjct: 46 RSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 51.6 bits (118), Expect = 8e-07 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 L VV N VTGK GVTQLNRL AHPPF W N++ Sbjct: 3 LGVVLNDVTGKTPGVTQLNRLAAHPPFANWRNSK 36 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 50.0 bits (114), Expect = 2e-06 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = -1 Query: 718 NRCGPXSLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 +RCGP KGGCA RRLSWVTP F TTASEL Sbjct: 69 DRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 49.2 bits (112), Expect = 4e-06 Identities = 29/60 (48%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Frame = -1 Query: 754 WPFXGXXXXGKXNRCGPX------SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 W G GK C SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 214 WKMPGRYLTGKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 49.2 bits (112), Expect = 4e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +3 Query: 612 YNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 YNVV +N GVTQLNRL AHPPF W N+E Sbjct: 12 YNVVHWENPGVTQLNRLAAHPPFASWRNSE 41 >SB_20754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNEXG 707 LAVV +N GVTQLNRLGAHPPF W N+E G Sbjct: 8 LAVVLQRRDWENPGVTQLNRLGAHPPFARWLNSEEG 43 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 49.2 bits (112), Expect = 4e-06 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -3 Query: 701 FVITPXGERGMCSKAIKLGNAQVFP 627 F ITP GERGMC KAIKLGNA+VFP Sbjct: 29 FAITPAGERGMCCKAIKLGNARVFP 53 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 48.8 bits (111), Expect = 6e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV G+N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDGENTGVTQLNRLAAHPPFASWRNSE 62 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 48.8 bits (111), Expect = 6e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV G+N GVTQLNRL AHPPF W N+E Sbjct: 54 LAVVLQRRDGENTGVTQLNRLAAHPPFASWRNSE 87 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 48.8 bits (111), Expect = 6e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV G+N GVTQLNRL AHPPF W N+E Sbjct: 695 LAVVLQRRDGENTGVTQLNRLAAHPPFASWRNSE 728 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 48.8 bits (111), Expect = 6e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV G+N GVTQLNRL AHPPF W N+E Sbjct: 66 LAVVLQRRDGENTGVTQLNRLAAHPPFASWRNSE 99 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 48.4 bits (110), Expect = 7e-06 Identities = 26/53 (49%), Positives = 28/53 (52%) Frame = -1 Query: 751 PFXGXXXXGKXNRCGPXSLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 P+ G + SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 354 PYSGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.4 bits (110), Expect = 7e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +3 Query: 612 YNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 YNV+ K GVTQLNRL AHPPF W N+E Sbjct: 12 YNVMLAKTPGVTQLNRLAAHPPFASWRNSE 41 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/47 (44%), Positives = 23/47 (48%) Frame = +1 Query: 583 SRITIHWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 SRITIHWPSF L KT + L L P + KAR D P Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKARTDRP 48 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/42 (54%), Positives = 26/42 (61%) Frame = +1 Query: 598 HWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 HWPSF GKT ALPNLIAL+HIP + +AR D P Sbjct: 5 HWPSFYNDVTGKTLALPNLIALQHIPTFASWRNSQEARTDRP 46 >SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV G+N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDGENPGVTQLNRLAAHPPFASWRNSE 62 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 48.0 bits (109), Expect = 1e-05 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -2 Query: 639 PGFSQSRRCKRRPVNCNTTHYRANW 565 PGF KRRPVNCNTTHYRANW Sbjct: 56 PGFPSHDVVKRRPVNCNTTHYRANW 80 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRF 632 SLL Q KGGCA RRLSWVTP F Sbjct: 36 SLLRQLAKGGCAARRLSWVTPGF 58 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 48.0 bits (109), Expect = 1e-05 Identities = 26/47 (55%), Positives = 29/47 (61%) Frame = +1 Query: 583 SRITIHWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 SRITIHWPSF GKT ALPNLIAL+ P + +AR D P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRP 48 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 47.6 bits (108), Expect = 1e-05 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = +3 Query: 612 YNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 YN TGK L TQLNRL AHPPF W N++ Sbjct: 55 YNAPTGKTLAYTQLNRLAAHPPFASWRNSQ 84 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/53 (49%), Positives = 30/53 (56%) Frame = +1 Query: 565 PIRPIVSRITIHWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 PIRPIVSRITIHWP+F + GKT A L L P + +AR D P Sbjct: 39 PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRP 91 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 234 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 902 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 14 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 389 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = +3 Query: 630 KNLGVTQLNRLGAHPPFXXWXNNEXGPXRLXFPKXXXP 743 +N GVTQLNRL AHPPF W N+E P R FP P Sbjct: 354 ENPGVTQLNRLAAHPPFASWRNSER-PHRSPFPTVAQP 390 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 599 TGRRLQRRDWEKPG 640 TGR LQRRDWE PG Sbjct: 344 TGRHLQRRDWENPG 357 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 305 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 63 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 47.2 bits (107), Expect = 2e-05 Identities = 30/69 (43%), Positives = 37/69 (53%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL*YDSL*GELGTGPPXEXXXXXFTQ 521 SLL Q KGGCA RRLSWVTP F TTASE D L L PP +++ Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL--VLERPPPRWSSNSPYSE 79 Query: 520 RFRSTVVVV 494 + +++ VV Sbjct: 80 SYYNSLAVV 88 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 118 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/47 (55%), Positives = 28/47 (59%) Frame = +1 Query: 583 SRITIHWPSFTTS*LGKTWALPNLIALEHIPLSPXGVITXKARXDXP 723 SRITIHWPSF GKT ALPNLIAL P + +AR D P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRP 48 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 45 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 281 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 265 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 254 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 279 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 463 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 132 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 298 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 148 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 341 SLLRQLVKGGCAARRLSWVTPGFSQSRRCKTTASEL 376 >SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV KN GVTQLNRL AHPPF W N+E Sbjct: 8 LAVVLQRRDWKNTGVTQLNRLAAHPPFASWRNSE 41 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 8 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 207 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 599 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 235 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 513 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 96 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 404 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 8 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 197 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W NNE Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNNE 82 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 SLL Q KGGCA RRLSWVTP F TTASEL Sbjct: 14 SLLRQLAKGGCAARRLSWVTPVFSQSRRCKTTASEL 49 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = -2 Query: 642 RPGFSQSRRCKRRPVNCNTTHYRANW 565 R GF KRRPVNCNTTHYRANW Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W NNE Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNNE 80 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -3 Query: 701 FVITPXGERGMCSKAIKLGNAQVFPSHDVV 612 F ITP GERGMC KAIKL VFPSHDVV Sbjct: 1855 FAITPAGERGMCCKAIKL-VTPVFPSHDVV 1883 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = -2 Query: 639 PGFSQSRRCKRRPVNCNTTHYRANW 565 P F KRRPVNCNTTHYRANW Sbjct: 1875 PVFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W NNE Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNNE 100 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W NNE Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNNE 73 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -2 Query: 708 GLXRYYXXWXKGDVLQGD*VG*RPGFSQSRRCK 610 G RYY W KGDVLQG PGFSQSRRCK Sbjct: 12 GPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCK 44 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/45 (48%), Positives = 23/45 (51%) Frame = -1 Query: 727 GKXNRCGPXSLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASEL 593 GK +RCGP KG RLSWVTP F TTASEL Sbjct: 6 GKGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_15928| Best HMM Match : BA14K (HMM E-Value=7) Length = 127 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W NNE Sbjct: 29 LAVVIQRRDWENPGVTQLNRLAAHPPFASWRNNE 62 >SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W NNE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWGNNE 62 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV + +N GVTQLNRL AHPPF W N+E Sbjct: 65 LAVVLQRLDWENPGVTQLNRLAAHPPFASWRNSE 98 >SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV + +N GVTQLNRL AHPPF W N+E Sbjct: 65 LAVVLQRLDWENPGVTQLNRLAAHPPFASWRNSE 98 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV KN GVTQLNRL AHPPF W N+E Sbjct: 39 LAVVLQRRDWKNPGVTQLNRLAAHPPFASWRNSE 72 >SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV KN G+TQLNRL AHPPF W N+E Sbjct: 15 LAVVLQRRDWKNPGITQLNRLAAHPPFASWRNSE 48 >SB_19937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 42 LAVVLQRRAWENTGVTQLNRLAAHPPFASWRNSE 75 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 75 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 35 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 68 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 54 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 87 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 90 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 123 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 75 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 51 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 84 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 52 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 85 >SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) Length = 241 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 151 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 184 >SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 28 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 61 >SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 8 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 41 >SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 57 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 90 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 46 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 79 >SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) Length = 499 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 408 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 441 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 95 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 128 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 37 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 70 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 35 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 68 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 515 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 548 Score = 41.9 bits (94), Expect = 6e-04 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTA 602 SLL Q KGGCA RRLSWVTP F TTA Sbjct: 197 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 229 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 67 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 100 >SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 8 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 41 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 36 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 69 >SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 56 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 89 >SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) Length = 148 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 57 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 90 >SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 56 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 89 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 49 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 82 >SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 36 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 69 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 55 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 88 >SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 84 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 117 >SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 66 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 99 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 71 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 104 >SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 1365 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 1398 >SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) Length = 248 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 158 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 191 >SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 41 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 74 >SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 59 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 92 >SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 37 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 70 >SB_14731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 8 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 41 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 189 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 222 >SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 87 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 120 >SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 63 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 96 >SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 38 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 71 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 95 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 128 >SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 71 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 104 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -1 Query: 700 SLLXQXXKGGCAPRRLSWVTPRFFPVTTL*TTASE 596 SLL Q KGGCA RRLSWVTP F TTASE Sbjct: 544 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 >SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 48 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 81 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 37 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 70 >SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) Length = 181 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 90 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 123 >SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_57755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 8 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 41 >SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 61 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 94 >SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 47 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 80 >SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) Length = 175 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 84 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 117 >SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 38 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 71 >SB_54475| Best HMM Match : Adeno_VII (HMM E-Value=9.4) Length = 165 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 74 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 107 >SB_53953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 8 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 41 >SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 41 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 74 >SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 65 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 98 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 88 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 121 >SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 136 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 169 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 53 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 86 >SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_48979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 8 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 41 >SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 97 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 130 >SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 41 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 74 >SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 45 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 78 >SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 51 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 84 >SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 66 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 99 >SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 38 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 71 >SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 39 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 72 >SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 37 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 70 >SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_42420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 8 LAVVLQRRDWENTGVTQLNRLAAHPPFDSWRNSE 41 >SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 75 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 108 >SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 49 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 82 >SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 55 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 88 >SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_37837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_36825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 56 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 89 >SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 58 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 91 >SB_35598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 250 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 160 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 193 >SB_34794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 8 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 41 >SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 50 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 83 >SB_33898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_33514| Best HMM Match : DUF503 (HMM E-Value=1.6) Length = 223 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 132 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 165 >SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 57 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 90 >SB_32886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 37 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 70 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 118 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 151 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 105 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 138 >SB_29948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_29695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 58 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 91 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 70 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 103 >SB_27907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_27247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 47 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 80 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 35 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 68 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 57 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 90 >SB_26184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_25988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 44 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 77 >SB_25331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 51 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 84 >SB_24868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_22584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 8 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 41 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 40 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 73 >SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 45 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 78 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 43 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 76 >SB_21002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 44 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 77 >SB_20750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 123 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 156 >SB_19365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 34 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 67 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 613 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 646 >SB_18964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_18148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 47 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 80 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 105 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 138 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 85 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 118 >SB_17776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 38 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 71 >SB_16561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 48 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 81 >SB_14675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 47 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 80 >SB_14548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_14046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_13642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 48 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 81 >SB_13143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 192 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 225 >SB_12757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 37 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 70 >SB_11792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 8 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 41 >SB_11340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 68 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 101 >SB_10857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +3 Query: 600 LAVVYNVVTGKNLGVTQLNRLGAHPPFXXWXNNE 701 LAVV +N GVTQLNRL AHPPF W N+E Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSE 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,277,581 Number of Sequences: 59808 Number of extensions: 393290 Number of successful extensions: 7810 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5041 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2431332827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -