BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0344.Seq (856 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 2.2 DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. 23 9.0 AY341214-1|AAR13778.1| 260|Anopheles gambiae SRPN9 protein. 23 9.0 AY341213-1|AAR13777.1| 260|Anopheles gambiae SRPN9 protein. 23 9.0 AY341212-1|AAR13776.1| 260|Anopheles gambiae SRPN9 protein. 23 9.0 AY341211-1|AAR13775.1| 260|Anopheles gambiae SRPN9 protein. 23 9.0 AY341210-1|AAR13774.1| 260|Anopheles gambiae SRPN9 protein. 23 9.0 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 25.4 bits (53), Expect = 2.2 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 130 PGCVSTDRNVRSKCRCSNVSCSSHYDAQLTAFFIDPR 20 P T NVR+ + + V+ S+ + QLTA DPR Sbjct: 1230 PNISLTHSNVRNSYQLTRVAPSNRTNNQLTAQHQDPR 1266 >DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. Length = 447 Score = 23.4 bits (48), Expect = 9.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 701 FVITPXGERGMCSKAIKLGNAQVFPSHDVVNDG 603 FV P E SK + A+ H+VVN+G Sbjct: 298 FVFLPPAEPNALSKLLSRLAAETDILHEVVNEG 330 >AY341214-1|AAR13778.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 23.4 bits (48), Expect = 9.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 701 FVITPXGERGMCSKAIKLGNAQVFPSHDVVNDG 603 FV P E SK + A+ H+VVN+G Sbjct: 172 FVFLPPAEPNALSKLLSRLAAETDILHEVVNEG 204 >AY341213-1|AAR13777.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 23.4 bits (48), Expect = 9.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 701 FVITPXGERGMCSKAIKLGNAQVFPSHDVVNDG 603 FV P E SK + A+ H+VVN+G Sbjct: 172 FVFLPPAEPNALSKLLSRLAAETDILHEVVNEG 204 >AY341212-1|AAR13776.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 23.4 bits (48), Expect = 9.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 701 FVITPXGERGMCSKAIKLGNAQVFPSHDVVNDG 603 FV P E SK + A+ H+VVN+G Sbjct: 172 FVFLPPAEPNALSKLLSRLAAETDILHEVVNEG 204 >AY341211-1|AAR13775.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 23.4 bits (48), Expect = 9.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 701 FVITPXGERGMCSKAIKLGNAQVFPSHDVVNDG 603 FV P E SK + A+ H+VVN+G Sbjct: 172 FVFLPPAEPNALSKLLSRLAAETDILHEVVNEG 204 >AY341210-1|AAR13774.1| 260|Anopheles gambiae SRPN9 protein. Length = 260 Score = 23.4 bits (48), Expect = 9.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 701 FVITPXGERGMCSKAIKLGNAQVFPSHDVVNDG 603 FV P E SK + A+ H+VVN+G Sbjct: 172 FVFLPPAEPNALSKLLSRLAAETDILHEVVNEG 204 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 745,567 Number of Sequences: 2352 Number of extensions: 12821 Number of successful extensions: 30 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90959220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -