BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0343.Seq (556 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41264-2|AAA82422.1| 124|Caenorhabditis elegans Ribosomal prote... 137 6e-33 AC006708-12|AAT81173.1| 908|Caenorhabditis elegans Hypothetical... 30 1.3 AC006708-11|AAF60426.2| 1019|Caenorhabditis elegans Hypothetical... 30 1.3 U61954-6|AAK29811.2| 459|Caenorhabditis elegans Sand endocytosi... 29 3.0 >U41264-2|AAA82422.1| 124|Caenorhabditis elegans Ribosomal protein, large subunitprotein 33 protein. Length = 124 Score = 137 bits (331), Expect = 6e-33 Identities = 66/117 (56%), Positives = 82/117 (70%) Frame = +3 Query: 132 VLRKASKPRHGRLYAKAVFTGYKRGLRNQHENTALLKVEGAKTVMMQSFYAGKHCVYVYR 311 V R+ S P GRLY KA+FTG+KRGLR Q E+T+LLK+EG FYAGK VY+Y+ Sbjct: 6 VARRPSAPTTGRLYVKAIFTGFKRGLRTQSEHTSLLKLEGVFNKEDAGFYAGKRVVYLYK 65 Query: 312 AKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRVMLY 482 A +T G T+ RAIWGK+TRPHGN+G+VRAKF N+P A+G RIRV+LY Sbjct: 66 AHNKTLKTG--HTVATRTRAIWGKITRPHGNAGAVRAKFHHNIPPSALGKRIRVLLY 120 >AC006708-12|AAT81173.1| 908|Caenorhabditis elegans Hypothetical protein Y110A7A.9b protein. Length = 908 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -3 Query: 434 RLELGSDTARVAMWAGHLAPDSTQLGFFATGTSGNWCPLLSSV-HIDAMLASI 279 ++ L T + W GHLA ++ Q+ A + NW ++ + DA+LA + Sbjct: 839 KMGLDDPTEVESKWIGHLADEAKQIRVLAEASRRNWPDVVEATSSADAILARL 891 >AC006708-11|AAF60426.2| 1019|Caenorhabditis elegans Hypothetical protein Y110A7A.9a protein. Length = 1019 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -3 Query: 434 RLELGSDTARVAMWAGHLAPDSTQLGFFATGTSGNWCPLLSSV-HIDAMLASI 279 ++ L T + W GHLA ++ Q+ A + NW ++ + DA+LA + Sbjct: 950 KMGLDDPTEVESKWIGHLADEAKQIRVLAEASRRNWPDVVEATSSADAILARL 1002 >U61954-6|AAK29811.2| 459|Caenorhabditis elegans Sand endocytosis protein familyprotein 1 protein. Length = 459 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = -3 Query: 395 WAGHLAPDSTQLGFFATGTSGNWCPLLSSVHIDAMLASIKRLHHYGL 255 W P GFF S WC + + +L S+KR H GL Sbjct: 261 WVPICLPRFNDTGFFYAYISYPWCNKEQDIPVCIVLLSVKRDHFDGL 307 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,493,055 Number of Sequences: 27780 Number of extensions: 242286 Number of successful extensions: 543 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 542 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1134321766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -