BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0340.Seq (770 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1470 - 33818394-33818625,33819636-33819743,33819895-33820028 51 1e-06 04_04_1400 - 33259716-33260069,33260172-33260219,33260471-332605... 29 5.4 03_06_0517 + 34466743-34466879,34468478-34468588,34468997-344690... 29 5.4 >04_04_1470 - 33818394-33818625,33819636-33819743,33819895-33820028 Length = 157 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/56 (37%), Positives = 38/56 (67%) Frame = -2 Query: 427 VRKLKFHEGKLLKKVDFISWKLDNNISEVKVMKKFCIQKREDYTKYNKLSRDIREL 260 +RKL+FHE KLLKK +F+ +K + + V +++ + +R+DY KYN + +++L Sbjct: 1 MRKLRFHEQKLLKKTNFLDFKREKGHRDAIVTQRYLLVERDDYKKYNGICLMVQKL 56 Score = 35.5 bits (78), Expect = 0.047 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 110 RRLPVLMVRNKMSETIKEATKFIEQGHV 27 RRL +MV+ K +E +KEA +I+QGHV Sbjct: 82 RRLATVMVKLKFAEHLKEAVTYIQQGHV 109 >04_04_1400 - 33259716-33260069,33260172-33260219,33260471-33260596, 33260850-33260900,33260963-33261055,33261217-33261272, 33261465-33261522,33262306-33262365,33262513-33262623, 33263368-33263949,33264026-33264097 Length = 536 Score = 28.7 bits (61), Expect = 5.4 Identities = 24/89 (26%), Positives = 41/89 (46%) Frame = -2 Query: 478 KQKHYITYILVLGVPKMVRKLKFHEGKLLKKVDFISWKLDNNISEVKVMKKFCIQKREDY 299 KQ+H+ T + L + KL+ +L K + W LD + +V +++ K Sbjct: 237 KQRHHSTRMEALA---RLAKLEVTNAELAKSLAREQWNLDLQVDQVAQLREEVDMKTLTQ 293 Query: 298 TKYNKLSRDIRELAKR*KTSIQIMNSGQS 212 KY R++AK KTS ++N +S Sbjct: 294 DKYK------RKIAKMQKTSPLLVNEIES 316 >03_06_0517 + 34466743-34466879,34468478-34468588,34468997-34469079, 34469287-34469404,34469503-34469714,34470167-34470651, 34470731-34470801,34470898-34470955,34471161-34471192, 34471193-34471449,34471820-34471974,34472353-34472636, 34472725-34472842,34473574-34473756,34473848-34474162 Length = 872 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 566 VVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLR 685 +VT N V + + H P WR+S +GRN+ ++ R Sbjct: 686 IVTTMNGNVFCFSTPSPHHPLKEWRSSNQGRNNAAYRYNR 725 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,791,065 Number of Sequences: 37544 Number of extensions: 425763 Number of successful extensions: 936 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 914 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 936 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2075009728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -