BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0340.Seq (770 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 9e-26 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 108 4e-24 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 106 2e-23 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 103 1e-22 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 5e-22 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 101 5e-22 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 5e-22 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 5e-22 SB_53825| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 6e-20 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 5e-19 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 6e-18 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 75 6e-14 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 6e-13 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 71 1e-12 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 70 2e-12 SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 70 2e-12 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) 68 7e-12 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 68 7e-12 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 68 7e-12 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 68 7e-12 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 68 7e-12 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 68 7e-12 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 68 7e-12 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 68 7e-12 SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) 68 7e-12 SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_14731| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 68 7e-12 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 68 7e-12 SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_57755| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 68 7e-12 SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_54475| Best HMM Match : Adeno_VII (HMM E-Value=9.4) 68 7e-12 SB_53953| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_48979| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_37837| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_36825| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_35598| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_34794| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_33898| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_33514| Best HMM Match : DUF503 (HMM E-Value=1.6) 68 7e-12 SB_32886| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_29948| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_29695| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_27907| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_27247| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_26184| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_25988| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_25331| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_24868| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_22584| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_21002| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_20750| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_19937| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_19365| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 68 7e-12 SB_18964| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_18148| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 68 7e-12 SB_17776| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_16561| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 68 7e-12 SB_14675| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_14548| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_14046| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_13642| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_13143| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 68 7e-12 SB_12757| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_11792| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_11340| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_10857| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_10117| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_10054| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_7369| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_6429| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_5748| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_4254| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_3679| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_1518| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 68 1e-11 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 68 1e-11 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 67 1e-11 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 67 1e-11 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 67 1e-11 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 67 1e-11 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 67 1e-11 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 67 1e-11 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 67 1e-11 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 67 1e-11 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 67 1e-11 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 67 1e-11 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 67 1e-11 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 67 1e-11 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 67 1e-11 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 67 1e-11 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 67 1e-11 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 67 1e-11 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 67 1e-11 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 67 1e-11 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 67 1e-11 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 67 1e-11 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 67 1e-11 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 67 1e-11 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 67 1e-11 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 67 1e-11 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 67 1e-11 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 67 1e-11 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 67 1e-11 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 67 1e-11 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 67 1e-11 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 67 1e-11 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 67 1e-11 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 67 1e-11 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 67 1e-11 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 67 1e-11 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 67 1e-11 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 67 1e-11 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 114 bits (274), Expect = 9e-26 Identities = 51/59 (86%), Positives = 52/59 (88%) Frame = -2 Query: 688 SAQLLERPIVAAFFAITPXGERGMCCKAIKLGNAQVFPSHDVVKRRPVNCNTTHYRANW 512 +AQLL R I A FAITP GERGMCCKAIKLGNA VFPSHDVVKRRPVNCNTTHYRANW Sbjct: 9 AAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 108 bits (260), Expect = 4e-24 Identities = 48/59 (81%), Positives = 51/59 (86%) Frame = -2 Query: 688 SAQLLERPIVAAFFAITPXGERGMCCKAIKLGNAQVFPSHDVVKRRPVNCNTTHYRANW 512 +AQLL R I A FAITP GERGMCCK+IKL +A VFPSHDVVKRRPVNCNTTHYRANW Sbjct: 3 AAQLLGRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 106 bits (254), Expect = 2e-23 Identities = 46/51 (90%), Positives = 46/51 (90%) Frame = -2 Query: 664 IVAAFFAITPXGERGMCCKAIKLGNAQVFPSHDVVKRRPVNCNTTHYRANW 512 I A FAITP GERGMCCKAIKLGNA VFPSHDVVKRRPVNCNTTHYRANW Sbjct: 3 IGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 103 bits (248), Expect = 1e-22 Identities = 46/62 (74%), Positives = 50/62 (80%) Frame = +2 Query: 503 GPYPIRPIVSRITIHWPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQL 682 G PIRPIVSRITIHWP+FYN TG+ L TQLNRLAAHPPFA WRNS+E R D P QQL Sbjct: 36 GGAPIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRPSQQL 95 Query: 683 RA 688 R+ Sbjct: 96 RS 97 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 102 bits (245), Expect = 3e-22 Identities = 45/53 (84%), Positives = 47/53 (88%) Frame = +2 Query: 530 SRITIHWPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 SRITIHWPSFYNVVTG+N GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 102 bits (245), Expect = 3e-22 Identities = 45/53 (84%), Positives = 47/53 (88%) Frame = +2 Query: 530 SRITIHWPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 SRITIHWPSFYNVVTG+N GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 101 bits (243), Expect = 5e-22 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -2 Query: 649 FAITPXGERGMCCKAIKLGNAQVFPSHDVVKRRPVNCNTTHYRANW 512 FAITP GERGMCCKAIKLGNA+ FPSHDVVKRRPVNCNTTHYRANW Sbjct: 14 FAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 101 bits (243), Expect = 5e-22 Identities = 47/57 (82%), Positives = 48/57 (84%) Frame = -2 Query: 685 AQLLERPIVAAFFAITPXGERGMCCKAIKLGNAQVFPSHDVVKRRPVNCNTTHYRAN 515 AQLL R I A FAITP GERGMCCKAIKLGNA+ FPSHD KRRPVNCNTTHYRAN Sbjct: 41 AQLLGRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 101 bits (243), Expect = 5e-22 Identities = 48/59 (81%), Positives = 49/59 (83%) Frame = -2 Query: 688 SAQLLERPIVAAFFAITPXGERGMCCKAIKLGNAQVFPSHDVVKRRPVNCNTTHYRANW 512 +AQLL R I A FAITP GERGMCCKAIKL VFPSHDVVKRRPVNCNTTHYRANW Sbjct: 1842 AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVTP-VFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 101 bits (243), Expect = 5e-22 Identities = 45/53 (84%), Positives = 47/53 (88%) Frame = +2 Query: 530 SRITIHWPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 SRITIHWPSFYNVVTG+N GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_53825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 99 bits (238), Expect = 2e-21 Identities = 48/62 (77%), Positives = 53/62 (85%) Frame = -2 Query: 430 MVRKLKFHEGKLLKKVDFISWKLDNNISEVKVMKKFCIQKREDYTKYNKLSRDIRELAKR 251 MVRKLKFHE KLLKKVDFISWK DNNI EVKV++K+ IQKREDYTKYNKLS I+ LA + Sbjct: 1 MVRKLKFHEQKLLKKVDFISWKSDNNIREVKVLRKYHIQKREDYTKYNKLSGLIKSLANK 60 Query: 250 *K 245 K Sbjct: 61 IK 62 Score = 98.7 bits (235), Expect = 5e-21 Identities = 44/76 (57%), Positives = 60/76 (78%) Frame = -1 Query: 254 KIKDLDPNNEFRTESSAQLLEKLYQIGLIPTRWDLALATNVSASSFCRRRLPVLMVRNKM 75 KIKDLDP + +R E++ Q+LEKL+ +GLI T+ +L V+ASSFCRRRLPV+MV KM Sbjct: 60 KIKDLDPKDPYRVEATEQILEKLHNMGLISTKKNLGQCNKVNASSFCRRRLPVVMVNLKM 119 Query: 74 SETIKEATKFIEQGHV 27 ++ +K+A K+IEQGHV Sbjct: 120 AQVVKDAVKYIEQGHV 135 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 99 bits (238), Expect = 2e-21 Identities = 44/53 (83%), Positives = 46/53 (86%) Frame = +2 Query: 530 SRITIHWPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 SRITIHWPSFYNVVTG+ L VTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 97.5 bits (232), Expect = 1e-20 Identities = 44/53 (83%), Positives = 45/53 (84%) Frame = +2 Query: 530 SRITIHWPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 SRITIHWPSFYNVV EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 95.1 bits (226), Expect = 6e-20 Identities = 44/57 (77%), Positives = 45/57 (78%) Frame = +2 Query: 515 IRPIVSRITIHWPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLR 685 IRPIVSRITIHWPSFY EN GV QLNRLAAHPPFA WR+SEE R D P QQLR Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEEARTDRPSQQLR 74 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = +2 Query: 545 HWPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 HWPSFYNVVTG+ LGVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 52 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 91.9 bits (218), Expect = 5e-19 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = +2 Query: 530 SRITIHWPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 SRITIHWPSFYNV+ + GVTQLNRLAAHPPFA WRNSE+ R D P QQLR+ Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRS 54 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 90.6 bits (215), Expect = 1e-18 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 1/64 (1%) Frame = -2 Query: 700 IPQFSAQLLERPIVAAFFAITPXGERGMCCKA-IKLGNAQVFPSHDVVKRRPVNCNTTHY 524 +P +AQLL R I A FAITP GE+G + +KLG Q FPSHDVVKRRPVNCNTTHY Sbjct: 39 LPSQAAQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHY 98 Query: 523 RANW 512 RANW Sbjct: 99 RANW 102 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 88.2 bits (209), Expect = 6e-18 Identities = 39/53 (73%), Positives = 42/53 (79%) Frame = +2 Query: 530 SRITIHWPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 SRITIHWPSFYNVVTG+ L + L LAAHPPFA WRNSEE R D P QQLR+ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 84.2 bits (199), Expect = 1e-16 Identities = 39/54 (72%), Positives = 41/54 (75%) Frame = +2 Query: 527 VSRITIHWPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 +SRITIHWPS EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 330 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 83.8 bits (198), Expect = 1e-16 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -2 Query: 628 ERGMCCKAIKLGNAQVFPSHDVVKRRPVNCNTTHYRAN 515 ERGMCCKAIKLGNA VF SHDVVKRRPVNCNTTHYRAN Sbjct: 3 ERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/53 (67%), Positives = 40/53 (75%) Frame = +2 Query: 530 SRITIHWPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 SRITIHWPSFYNVVTG+ L + L L HPPFA WRNSEE R D P Q+LR+ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRS 54 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 79.4 bits (187), Expect = 3e-15 Identities = 36/53 (67%), Positives = 39/53 (73%) Frame = +2 Query: 530 SRITIHWPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 SRITIHWPSFYNVVTG+ L + L L PPFA WRNSEE R D P QQLR+ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRS 54 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 79.0 bits (186), Expect = 4e-15 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = -2 Query: 682 QLLERPIVAAFFAITPXGERGMCCKAIKLGNAQVFPSHDVVKRRPVNCNTTHYRANW 512 QL+ R VA A TP G++ M ++ +A VFPSHDVVKRRPVNCNTTHYRANW Sbjct: 3 QLIPRETVAVVLATTPSGDKSMYSESNNKSHAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 77.0 bits (181), Expect = 2e-14 Identities = 37/48 (77%), Positives = 37/48 (77%) Frame = -1 Query: 683 ATVGKAXRCGLLRYYAXWRKGDVLQGD*VG*RPGFPQSRRCKTTASEL 540 ATVGK RCG LRYYA WRKGDVLQG PGF QSRRCKTTASEL Sbjct: 3 ATVGKGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 76.2 bits (179), Expect = 3e-14 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = +2 Query: 560 YNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 YNVVTG+ GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 12 YNVVTGKTPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 74.9 bits (176), Expect = 6e-14 Identities = 39/62 (62%), Positives = 40/62 (64%) Frame = +2 Query: 503 GPYPIRPIVSRITIHWPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQL 682 G PIRPIVS ITIHWPSFYN VT AHPPFA WRNSEE R D P QQL Sbjct: 38 GGAPIRPIVSHITIHWPSFYNGVT-------------AHPPFASWRNSEEARTDRPSQQL 84 Query: 683 RA 688 R+ Sbjct: 85 RS 86 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 71.7 bits (168), Expect = 6e-13 Identities = 34/48 (70%), Positives = 34/48 (70%) Frame = -1 Query: 683 ATVGKAXRCGLLRYYAXWRKGDVLQGD*VG*RPGFPQSRRCKTTASEL 540 ATVGK RCG LRYYA WRKGD G PGF QSRRCKTTASEL Sbjct: 32 ATVGKGDRCGPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 71.3 bits (167), Expect = 8e-13 Identities = 44/105 (41%), Positives = 58/105 (55%), Gaps = 10/105 (9%) Frame = +2 Query: 404 FMKFKFSDHFGNTEHKDIGYVVFLLI*KKNSRGGPYPIRPIVSRITIHWP---SFYNVVT 574 F+KF + G +H + +V + + +S G P + R + + P S+YN + Sbjct: 26 FVKFNRTTMIGPKKHTALVIIVGMDVIPDDSPGDPLVLERPPPRWSSNSPYSESYYNSLA 85 Query: 575 -------GENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 86 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 130 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +2 Query: 575 GENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 GEN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 38 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +2 Query: 575 GENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 GEN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 63 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 100 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +2 Query: 575 GENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 GEN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 704 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 741 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +2 Query: 575 GENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 GEN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 75 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 112 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 70.1 bits (164), Expect = 2e-12 Identities = 35/56 (62%), Positives = 39/56 (69%), Gaps = 7/56 (12%) Frame = +2 Query: 542 IHWPSFYNVVT-------GENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 IH+ S+YN + EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 1464 IHYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 1519 >SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 70.1 bits (164), Expect = 2e-12 Identities = 41/93 (44%), Positives = 53/93 (56%), Gaps = 10/93 (10%) Frame = +2 Query: 440 TEHKDIGYVVFLLI*KKNSRGGPYPIRPIVSRITIH---WPSFYNVVT-------GENLG 589 TE + + Y V++ I + GG R + + + + S+YN + EN G Sbjct: 11 TESRALDYGVYVEIIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENTG 70 Query: 590 VTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 VTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 71 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 103 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 69.7 bits (163), Expect = 2e-12 Identities = 36/63 (57%), Positives = 41/63 (65%), Gaps = 7/63 (11%) Frame = +2 Query: 521 PIVSRITIHWPSFYNVVT-------GENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQ 679 P V + + H S+YN + EN GVTQLNRLAAHPPFA WRNSEE R D P QQ Sbjct: 46 PFVPKSSRHSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 105 Query: 680 LRA 688 LR+ Sbjct: 106 LRS 108 >SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 69.7 bits (163), Expect = 2e-12 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +2 Query: 575 GENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 GEN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 38 GENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 69.3 bits (162), Expect = 3e-12 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Frame = +2 Query: 530 SRITIHWPSFYNVVTGENLG-VTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 SRITIHWPSFYNVVTG+N G L L P A WRNSEE R D P QQLR+ Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNSEEARTDRPSQQLRS 55 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 68.9 bits (161), Expect = 4e-12 Identities = 46/101 (45%), Positives = 60/101 (59%), Gaps = 14/101 (13%) Frame = +2 Query: 428 HFGNTE-HKDIGYVVFLLI*KKN---SRGGPYPIRPIVSRITIHWP---SFYNVVT---- 574 HF +T +IG+VV++ I +++ S G P + R + + P S+YN + Sbjct: 3 HFTDTLISANIGHVVYINIIRQSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQ 62 Query: 575 ---GENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 63 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 103 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 68.9 bits (161), Expect = 4e-12 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRAELRNGKC 709 EN GVTQLNRLAAHPPFA WRN+EE R D P QQLR+ NG+C Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNNEEARTDRPSQQLRS--LNGEC 91 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 40 LAVVLQRRDWENPG 53 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 68.9 bits (161), Expect = 4e-12 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = -1 Query: 677 VGKAXRCGLLRYYAXWRKGDVLQGD*VG*RPGFPQSRRCKTTASEL 540 +GK RCG LRYYA WRKGDVLQ PGF QSRRCKTTASEL Sbjct: 5 LGKGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 68.5 bits (160), Expect = 6e-12 Identities = 34/54 (62%), Positives = 38/54 (70%), Gaps = 7/54 (12%) Frame = +2 Query: 548 WPSFYNVVTG-------ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 + S+YN + G EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 45 YESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 98 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 68.5 bits (160), Expect = 6e-12 Identities = 34/59 (57%), Positives = 41/59 (69%), Gaps = 3/59 (5%) Frame = +2 Query: 521 PIVSRITIHWPSFYNVVTG---ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 P++ R+ ++ S V+ EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 108 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 68.5 bits (160), Expect = 6e-12 Identities = 34/54 (62%), Positives = 38/54 (70%), Gaps = 7/54 (12%) Frame = +2 Query: 548 WPSFYNVVTG-------ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 + S+YN + G EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 58 YESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 111 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 52 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 88 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 45 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 81 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) Length = 282 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/47 (63%), Positives = 32/47 (68%) Frame = +2 Query: 548 WPSFYNVVTGENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 WPS YN N GVTQLNRL AH PF WRNSEE R D P QQ+R+ Sbjct: 218 WPSIYNDRDWNNSGVTQLNRLVAHLPFVSWRNSEEARTDRPSQQMRS 264 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 64 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 100 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 100 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 136 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 52 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 88 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 61 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 97 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 62 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 98 >SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) Length = 241 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 161 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 197 >SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 38 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 74 >SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 67 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 103 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 56 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 92 >SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) Length = 499 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 418 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 454 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 105 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 141 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 47 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 83 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 45 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 81 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 525 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 561 Score = 57.6 bits (133), Expect = 1e-08 Identities = 28/44 (63%), Positives = 29/44 (65%) Frame = -3 Query: 708 HLPFRNSARNCWKGXXXXXXXXXRQXAKGGCAARRLSWVTPRFS 577 H PFR RNCW+G RQ AKGGCAARRLSWVTP FS Sbjct: 179 HSPFR--LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFS 220 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 587 PGFPQSRRCKTTA 549 PGF QSRRCKTTA Sbjct: 217 PGFSQSRRCKTTA 229 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 77 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 113 >SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 46 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 82 >SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 66 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 102 >SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) Length = 148 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 67 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 103 >SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 66 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 102 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 59 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 95 >SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 46 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 82 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 65 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 101 >SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 94 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 130 >SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 76 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 112 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 81 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 117 >SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 1375 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 1411 >SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) Length = 248 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 168 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 204 >SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 51 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 87 >SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 69 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 105 >SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 47 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 83 >SB_14731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 199 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 235 >SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 97 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 133 >SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 73 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 109 >SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 48 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 84 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 105 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 141 >SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 81 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 117 >SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 58 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 94 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 47 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 83 >SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) Length = 181 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 100 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 136 >SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_57755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 71 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 107 >SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 57 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 93 >SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) Length = 175 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 94 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 130 >SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 48 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 84 >SB_54475| Best HMM Match : Adeno_VII (HMM E-Value=9.4) Length = 165 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 84 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 120 >SB_53953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLR 685 EN GVTQLNRLAAHPPFA WRNSEE R+D P QQLR Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARSDRPSQQLR 53 >SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 51 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 87 >SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 75 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 111 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 98 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 134 >SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 146 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 182 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 63 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 99 >SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_48979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 107 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 143 >SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 51 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 87 >SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 55 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 91 >SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 61 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 97 >SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 76 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 112 >SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 48 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 84 >SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 49 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 85 >SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 47 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 83 >SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 85 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 121 >SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 59 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 95 >SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 65 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 101 >SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_37837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_36825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 66 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 102 >SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 68 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 104 >SB_35598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 250 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 170 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 206 >SB_34794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 60 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 96 >SB_33898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_33514| Best HMM Match : DUF503 (HMM E-Value=1.6) Length = 223 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 142 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 178 >SB_32886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 47 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 83 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 128 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 164 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 115 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 151 >SB_29948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_29695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 68 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 104 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 80 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 116 >SB_27907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_27247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 57 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 93 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 45 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 81 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 67 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 103 >SB_26184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_25988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 54 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 90 >SB_25331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 61 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 97 >SB_24868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_22584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 50 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 86 >SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 55 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 91 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 53 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 89 >SB_21002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 54 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 90 >SB_20750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_19937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 52 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 88 >SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 133 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 169 >SB_19365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 44 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 80 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 623 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 659 >SB_18964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_18148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 57 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 93 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 115 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 151 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 95 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 131 >SB_17776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 48 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 84 >SB_16561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 58 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 94 >SB_14675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 57 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 93 >SB_14548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_14046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_13642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 58 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 94 >SB_13143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 202 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 238 >SB_12757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 47 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 83 >SB_11792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 54 >SB_11340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 78 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 114 >SB_10857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 146 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 182 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 51 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 87 >SB_10117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_10054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 101 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 137 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 56 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 92 >SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 64 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 100 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 79 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 115 >SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 57 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 93 >SB_7369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_6429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 62 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 98 >SB_5748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 48 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 84 >SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 45 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 81 >SB_4254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_3679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 59 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 95 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 48 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 84 >SB_1518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 >SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 68.1 bits (159), Expect = 7e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 63 ENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 99 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 67.7 bits (158), Expect = 1e-11 Identities = 37/63 (58%), Positives = 42/63 (66%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRAELRNGKCKR*NLLKSRXILVKQV 757 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ NG+ + L R + KQ Sbjct: 110 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS--LNGEWR----LMRRQVRAKQR 163 Query: 758 HFN 766 +N Sbjct: 164 LYN 166 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 100 LAVVLQRRDWENPG 113 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 67.7 bits (158), Expect = 1e-11 Identities = 34/60 (56%), Positives = 41/60 (68%), Gaps = 3/60 (5%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA---ELRNGKCKR*NLLKSRXILV 748 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ E R +C + + + +L+ Sbjct: 180 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCDKSFIFREVLLLI 239 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 170 LAVVLQRRDWENPG 183 >SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 67.7 bits (158), Expect = 1e-11 Identities = 37/73 (50%), Positives = 45/73 (61%), Gaps = 10/73 (13%) Frame = +2 Query: 500 GGPYPIRPIVSRITIH---WPSFYNVVT-------GENLGVTQLNRLAAHPPFAXWRNSE 649 GG R +V+ + + + S+YN + EN GVTQLNRLAAHPPFA WRNSE Sbjct: 15 GGSTSSRAVVTAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 74 Query: 650 EGRNDXPFQQLRA 688 E R D P QQLR+ Sbjct: 75 EARTDRPSQQLRS 87 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/60 (58%), Positives = 39/60 (65%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRAELRNGKCKR*NLLKSRXILVKQV 757 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ + R LL +L+ V Sbjct: 447 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCVLMTAV 506 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 437 LAVVLQRRDWENPG 450 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 45 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 81 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 35 LAVVLQRRDWENPG 48 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 25 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 61 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 29 LAVVLQRRDWENPG 42 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 108 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 62 LAVVLQRRDWENPG 75 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 54 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 90 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 44 LAVVLQRRDWENPG 57 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 82 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 36 LAVVLQRRDWENPG 49 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 108 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 62 LAVVLQRRDWENPG 75 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 77 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 113 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 67 LAVVLQRRDWENPG 80 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 48 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 84 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 38 LAVVLQRRDWENPG 51 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 104 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 58 LAVVLQRRDWENPG 71 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 80 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 116 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 70 LAVVLQRRDWENPG 83 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 75 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 29 LAVVLQRRDWENPG 42 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 56 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 92 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 46 LAVVLQRRDWENPG 59 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 45 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 81 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 35 LAVVLQRRDWENPG 48 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 35 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 71 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 25 LAVVLQRRDWENPG 38 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 60 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 96 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 50 LAVVLQRRDWENPG 63 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 69 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 105 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 59 LAVVLQRRDWENPG 72 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 63 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 99 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 53 LAVVLQRRDWENPG 66 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 79 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 115 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 69 LAVVLQRRDWENPG 82 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 103 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 57 LAVVLQRRDWENPG 70 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 86 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 40 LAVVLQRRDWENPG 53 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 86 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 226 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 262 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 216 LAVVLQRRDWENPG 229 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 121 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 157 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 111 LAVVLQRRDWENPG 124 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 59 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 95 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 49 LAVVLQRRDWENPG 62 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 578 ENLGVTQLNRLAAHPPFAXWRNSEEGRNDXPFQQLRA 688 EN GVTQLNRLAAHPPFA WRNSEE R D P QQLR+ Sbjct: 38 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 74 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 547 LAVVLQRRDWGKPG 588 LAVVLQRRDW PG Sbjct: 28 LAVVLQRRDWENPG 41 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,241,463 Number of Sequences: 59808 Number of extensions: 508043 Number of successful extensions: 7934 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7900 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -