BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0340.Seq (770 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 26 1.5 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 2.0 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 556 RRPVNCNTTHYRANWVRAPPRVFFLYKQKHY 464 R+ VNC T R ++P + F + KHY Sbjct: 12 RQAVNCTATGRRCKQRKSPYTIDFEHYDKHY 42 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.4 bits (53), Expect = 2.0 Identities = 8/39 (20%), Positives = 23/39 (58%) Frame = -2 Query: 379 FISWKLDNNISEVKVMKKFCIQKREDYTKYNKLSRDIRE 263 ++ +L+N +S++++++ + R D + + D+RE Sbjct: 3240 YLQKRLENGLSDLELLQSQAVANRSDMDWFGCMLEDLRE 3278 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 822,180 Number of Sequences: 2352 Number of extensions: 16586 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -