BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0340.Seq (770 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97189-6|AAC48162.1| 183|Caenorhabditis elegans Hypothetical pr... 66 2e-11 U00037-2|AAA50662.1| 212|Caenorhabditis elegans Hypothetical pr... 29 3.7 AF140272-1|AAD34863.1| 212|Caenorhabditis elegans NADH oxidored... 29 3.7 Z81487-7|CAB04001.2| 495|Caenorhabditis elegans Hypothetical pr... 28 6.4 AL021470-4|CAA16294.2| 495|Caenorhabditis elegans Hypothetical ... 28 6.4 >U97189-6|AAC48162.1| 183|Caenorhabditis elegans Hypothetical protein C48B6.2 protein. Length = 183 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = -2 Query: 430 MVRKLKFHEGKLLKKVDFISWKLDNNISEVKVMKKFCIQKREDYTKYNKLSRDIRELA 257 MVRKLK HE KLLKK DF+SW++D + +++KF ++KRE Y YN L+ RE+A Sbjct: 1 MVRKLKTHEQKLLKKTDFMSWQVDQQGKQGDMLRKFYVKKREHYALYNTLAAKSREVA 58 Score = 66.1 bits (154), Expect = 3e-11 Identities = 32/75 (42%), Positives = 47/75 (62%) Frame = -1 Query: 251 IKDLDPNNEFRTESSAQLLEKLYQIGLIPTRWDLALATNVSASSFCRRRLPVLMVRNKMS 72 IK+L ++ FR++ + +L K Y GL+PT L V+ +SF RRRLPV+M M Sbjct: 61 IKNLSESDPFRSKCTEDMLTKFYAAGLVPTSDTLERIGKVTGASFARRRLPVVMRNIGMC 120 Query: 71 ETIKEATKFIEQGHV 27 E++K A+ +EQGHV Sbjct: 121 ESVKTASDLVEQGHV 135 >U00037-2|AAA50662.1| 212|Caenorhabditis elegans Hypothetical protein T20H4.5 protein. Length = 212 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -1 Query: 236 PNNEFRTESSAQLLEKLYQIGLIPTRWDLALATNVSASSFCR 111 PN E+ TE+ +LL ++ L RW+ LA+N+ A R Sbjct: 171 PNFEYSTETHEELLYNKEKLLLNGDRWEPELASNLQAEYLYR 212 >AF140272-1|AAD34863.1| 212|Caenorhabditis elegans NADH oxidoreductase complex I 23.8kDa subunit protein. Length = 212 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -1 Query: 236 PNNEFRTESSAQLLEKLYQIGLIPTRWDLALATNVSASSFCR 111 PN E+ TE+ +LL ++ L RW+ LA+N+ A R Sbjct: 171 PNFEYSTETHEELLYNKEKLLLNGDRWEPELASNLQAEYLYR 212 >Z81487-7|CAB04001.2| 495|Caenorhabditis elegans Hypothetical protein Y17D7A.4 protein. Length = 495 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/83 (21%), Positives = 39/83 (46%) Frame = -2 Query: 451 LVLGVPKMVRKLKFHEGKLLKKVDFISWKLDNNISEVKVMKKFCIQKREDYTKYNKLSRD 272 +++ V ++ ++L H G+ + I + N I+ K+F + KR+++ L Sbjct: 143 ILMEVEELFKELDAHGGEEIDLPKLIDRSVGNVINLTLFNKRFDMDKRDEFAHLKSLIDG 202 Query: 271 IRELAKR*KTSIQIMNSGQSQVL 203 +R + + + IQ + S VL Sbjct: 203 MRNVTSQFRYLIQYLVPWTSTVL 225 >AL021470-4|CAA16294.2| 495|Caenorhabditis elegans Hypothetical protein Y17D7A.4 protein. Length = 495 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/83 (21%), Positives = 39/83 (46%) Frame = -2 Query: 451 LVLGVPKMVRKLKFHEGKLLKKVDFISWKLDNNISEVKVMKKFCIQKREDYTKYNKLSRD 272 +++ V ++ ++L H G+ + I + N I+ K+F + KR+++ L Sbjct: 143 ILMEVEELFKELDAHGGEEIDLPKLIDRSVGNVINLTLFNKRFDMDKRDEFAHLKSLIDG 202 Query: 271 IRELAKR*KTSIQIMNSGQSQVL 203 +R + + + IQ + S VL Sbjct: 203 MRNVTSQFRYLIQYLVPWTSTVL 225 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,105,529 Number of Sequences: 27780 Number of extensions: 382838 Number of successful extensions: 959 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 959 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1851132448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -