BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0287.Seq (825 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 26 1.2 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 24 4.9 AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal... 23 8.6 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 26.2 bits (55), Expect = 1.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 506 QQMFTIDFYGEGVTSCNKNETRKIIICIITG 414 QQ +I + EGV + RK ++C ITG Sbjct: 118 QQALSIVHHPEGVMGPTRRMIRKPLVCAITG 148 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 24.2 bits (50), Expect = 4.9 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 357 GRNRQGGGTHPRGLTRGPTTSNYANYNFAGFI 452 G+ Q GG +PRG R + Y + G++ Sbjct: 253 GQYDQRGGNYPRGTERNRNGNGYGAGDDGGYV 284 >AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 131 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 458 NKNETRKIIICIITGGRTSCKSAR 387 +KNE ++ +CI T GR S + R Sbjct: 31 HKNEINEMRVCIGTNGRMSVPANR 54 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 852,121 Number of Sequences: 2352 Number of extensions: 17661 Number of successful extensions: 51 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87734433 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -