BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0285.Seq (982 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 47 3e-05 SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 42 6e-04 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 41 0.001 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 40 0.003 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 40 0.003 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 40 0.003 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 39 0.005 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 38 0.009 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 38 0.009 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 38 0.009 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 38 0.009 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 38 0.009 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 38 0.009 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 38 0.009 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 38 0.009 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 38 0.009 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 38 0.009 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 38 0.009 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 38 0.009 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 38 0.009 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 38 0.009 SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) 38 0.009 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 38 0.009 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 38 0.009 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 38 0.009 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16189| Best HMM Match : rve (HMM E-Value=0.3) 38 0.009 SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 38 0.009 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) 38 0.009 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) 38 0.009 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 38 0.009 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) 38 0.009 SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 38 0.009 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 38 0.009 SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 38 0.009 SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) 38 0.009 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) 38 0.009 SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) 38 0.009 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 38 0.009 SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 38 0.009 SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50064| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49959| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49504| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_48942| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1) 38 0.009 SB_48427| Best HMM Match : Dynactin_p22 (HMM E-Value=2.7) 38 0.009 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 38 0.009 SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7) 38 0.009 SB_47953| Best HMM Match : DUF911 (HMM E-Value=9.5) 38 0.009 SB_47489| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47379| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47288| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) 38 0.009 SB_46342| Best HMM Match : Secretin_N_2 (HMM E-Value=6.7) 38 0.009 SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 38 0.009 SB_45832| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45288| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44667| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44607| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44433| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43889| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43888| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43792| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43429| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43017| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) 38 0.009 SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42668| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42658| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42652| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42572| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42400| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42250| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41999| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41852| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41807| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41675| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41674| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41363| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41117| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40426| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40365| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40340| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40206| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40029| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39985| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39620| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38461| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=6.5) 38 0.009 SB_38310| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38197| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37918| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37627| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37251| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37090| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36577| Best HMM Match : CC (HMM E-Value=7.9) 38 0.009 SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35411| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35083| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34810| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34588| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34053| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34052| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33852| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) 38 0.009 SB_33774| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33771| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33605| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33361| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33192| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33060| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_32479| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_32421| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_32220| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63) 38 0.009 SB_31938| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31587| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31495| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30975| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30661| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30447| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30018| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29984| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29560| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29205| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29171| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28658| Best HMM Match : I-set (HMM E-Value=1.5) 38 0.009 SB_28613| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28406| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28253| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28215| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28209| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28018| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_27485| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26864| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26690| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26211| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26011| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 38 0.009 SB_25260| Best HMM Match : PqiA (HMM E-Value=0.3) 38 0.009 SB_25256| Best HMM Match : G-patch (HMM E-Value=3.7) 38 0.009 SB_25128| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24406| Best HMM Match : DUF536 (HMM E-Value=1.5) 38 0.009 SB_24116| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23634| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23336| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_22975| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_22925| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_22609| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21773| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21563| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21340| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21182| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_20892| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3) 38 0.009 SB_20728| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_20345| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_20175| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_20124| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19991| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19473| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19471| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19304| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19023| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 38 0.009 SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18273| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18166| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18058| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18032| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17731| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17618| Best HMM Match : Bombolitin (HMM E-Value=2.1e-07) 38 0.009 SB_17401| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17365| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) 38 0.009 SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16801| Best HMM Match : MSSP (HMM E-Value=0.31) 38 0.009 SB_16735| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16611| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16600| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16365| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16176| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16128| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16003| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_15793| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_15304| Best HMM Match : Herpes_UL49_5 (HMM E-Value=1.3) 38 0.009 SB_15133| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14619| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14400| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14226| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14098| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 38 0.009 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 38 0.009 SB_13829| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13824| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13618| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13406| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13252| Best HMM Match : Ligase_CoA (HMM E-Value=9.1) 38 0.009 SB_13028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13007| Best HMM Match : DUF1566 (HMM E-Value=6.2) 38 0.009 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_12650| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_12577| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_12301| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_12180| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_11368| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10991| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10540| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9824| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9727| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9660| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9352| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9104| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8880| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8518| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8428| Best HMM Match : Glyco_hydro_2 (HMM E-Value=0.3) 38 0.009 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) 38 0.009 SB_7695| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7685| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7672| Best HMM Match : 7tm_1 (HMM E-Value=0.48) 38 0.009 SB_7569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7353| Best HMM Match : CAT (HMM E-Value=7.9e-08) 38 0.009 SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7229| Best HMM Match : Neurokinin_B (HMM E-Value=7.9) 38 0.009 SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7001| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_6806| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 50.4 bits (115), Expect = 2e-06 Identities = 30/79 (37%), Positives = 35/79 (44%) Frame = -2 Query: 972 YRNFXKNFTVXNLPFPISRGQFLERXIXAGLFRYYPXLXKGGFAARRIKLG*PPGFSQSR 793 Y+ ++ + P Q L R I AGLF P KG +KLG GF Sbjct: 25 YQQGHQDLFILRSDLPSQAAQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHD 84 Query: 792 RCKNDRPSELNTTHYRANW 736 K RP NTTHYRANW Sbjct: 85 VVKR-RPVNCNTTHYRANW 102 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = -3 Query: 878 FVITPXCXKGDLLQGGLSWXNPQVFPSHDVVKTTGPVN 765 F ITP KGD+LQG L Q FPSHDVVK PVN Sbjct: 56 FAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRR-PVN 92 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 50.0 bits (114), Expect = 3e-06 Identities = 30/67 (44%), Positives = 33/67 (49%) Frame = -2 Query: 936 LPFPISRGQFLERXIXAGLFRYYPXLXKGGFAARRIKLG*PPGFSQSRRCKNDRPSELNT 757 +PF I Q L R I AGLF P + G + IKLG F K RP NT Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPA-GERGMCCKAIKLGNASVFPSHDVVKR-RPVNCNT 60 Query: 756 THYRANW 736 THYRANW Sbjct: 61 THYRANW 67 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 48.4 bits (110), Expect = 9e-06 Identities = 36/101 (35%), Positives = 48/101 (47%), Gaps = 11/101 (10%) Frame = +3 Query: 585 SKVDKGRHLKDASPVL-DHAICKSYPDSSKLTTFXREGLRSIGFDSKGGPVX-------- 737 +K D+ KD + +L D + K + +++K F E S G P+ Sbjct: 13 TKADEDAIQKDVAELLVDTGVAKGFKNTTKDAEFFAENGSESNSCSPGDPLVLERPPPRW 72 Query: 738 --NSPYSESYSIHWAGRFYNVVTGKNLGVXPT*SALQQIPL 854 NSPY +IHW FYNVVTGK L + P ALQ IPL Sbjct: 73 SSNSPYMSRITIHWPS-FYNVVTGKTLAL-PNLIALQHIPL 111 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = +3 Query: 762 SIHWAGRFYNVVTGKNLGVXPT*SALQQIPLXAXWGNNEK 881 +IHW FYNVVTGKN G P+ LQ IPL A W N+E+ Sbjct: 5 TIHWPS-FYNVVTGKNTGREPSLFDLQYIPLVASWRNSEE 43 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 46.8 bits (106), Expect = 3e-05 Identities = 30/67 (44%), Positives = 33/67 (49%) Frame = -2 Query: 936 LPFPISRGQFLERXIXAGLFRYYPXLXKGGFAARRIKLG*PPGFSQSRRCKNDRPSELNT 757 +PF I Q L R I AGLF P + G + IKL P F K RP NT Sbjct: 1836 VPFAIQAAQLLGRAIGAGLFAITPA-GERGMCCKAIKLV-TPVFPSHDVVKR-RPVNCNT 1892 Query: 756 THYRANW 736 THYRANW Sbjct: 1893 THYRANW 1899 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 46.8 bits (106), Expect = 3e-05 Identities = 29/66 (43%), Positives = 35/66 (53%) Frame = +1 Query: 736 PIRPIVSRIQFTGPVVFTTS*LGKTWGLXQLNPPCSKSPFXQXGVITKKARXDGPFQKLA 915 PIRPIVSRI P F + GKT QLN + PF +++AR D P Q+L Sbjct: 39 PIRPIVSRITIHWP-AFYNAPTGKTLAYTQLNRLAAHPPFASWR-NSQEARADRPSQQLR 96 Query: 916 PXNGEW 933 NGEW Sbjct: 97 SLNGEW 102 >SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 44.8 bits (101), Expect = 1e-04 Identities = 23/51 (45%), Positives = 29/51 (56%) Frame = +3 Query: 780 RFYNVVTGKNLGVXPT*SALQQIPLXAXWGNNEKGPXRWXFPKIGPXKWGM 932 R Y+VVTGK L V P+ +ALQ IP A W + P R FP+ +W M Sbjct: 11 RVYDVVTGKTLAV-PSLNALQHIPHFASWRTYPRSPHRSPFPRDAQPEWRM 60 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/40 (55%), Positives = 26/40 (65%) Frame = +3 Query: 762 SIHWAGRFYNVVTGKNLGVXPT*SALQQIPLXAXWGNNEK 881 +IHW FYNVVTGK L + P ALQ IP A W N+E+ Sbjct: 5 TIHWPS-FYNVVTGKTLAL-PNLIALQHIPPFASWRNSEE 42 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 42.3 bits (95), Expect = 6e-04 Identities = 27/58 (46%), Positives = 30/58 (51%) Frame = -2 Query: 912 QFLERXIXAGLFRYYPXLXKGGFAARRIKLG*PPGFSQSRRCKNDRPSELNTTHYRAN 739 Q L R I AGLF P + G + IKLG GF S + RP NTTHYRAN Sbjct: 42 QLLGRSIGAGLFAITPA-GERGMCCKAIKLGNARGFP-SHDGEKRRPVNCNTTHYRAN 97 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL FLQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VFLQRRDWENP-GVTQLNRLAAHPP 90 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/59 (44%), Positives = 28/59 (47%) Frame = -2 Query: 912 QFLERXIXAGLFRYYPXLXKGGFAARRIKLG*PPGFSQSRRCKNDRPSELNTTHYRANW 736 Q L R I AGLF P + G + IKL F K RP NTTHYRANW Sbjct: 5 QLLGRAIGAGLFAITPA-GERGMCCKSIKLAHASVFPSHDVVKR-RPVNCNTTHYRANW 61 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/43 (51%), Positives = 25/43 (58%) Frame = -2 Query: 912 QFLERXIXAGLFRYYPXLXKGGFAARRIKLG*PPGFSQSRRCK 784 Q ++ G RYY KGG AARR+ PGFSQSRRCK Sbjct: 63 QVTQQGDRCGPLRYYASWRKGGCAARRLSWV-TPGFSQSRRCK 104 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -2 Query: 861 LXKGGFAARRIKLG*PPGFSQSRRCKNDRPSELNTTHYRANW 736 L KGG AARR+ PGF K RP NTTHYRANW Sbjct: 41 LAKGGCAARRLSWV-TPGFPSHDVVKR-RPVNCNTTHYRANW 80 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/59 (49%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Frame = -2 Query: 933 PFPISRGQFLE-RXIXAG-LFRYYPXLXKGGFAARRIKLG*PPGFSQSRRCKNDRPSEL 763 PF I Q LE R + A L R L KGG AARR+ PGFSQSRRCK ++L Sbjct: 11 PFAIQAAQLLEGRSVRASSLLRQ---LAKGGCAARRLSWV-TPGFSQSRRCKTTASAKL 65 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = -2 Query: 861 LXKGGFAARRIKLG*PPGFSQSRRCKNDRPSELNTTHYRANW 736 L KGG AARR+ G P S RP NTTHYRANW Sbjct: 612 LAKGGCAARRLSWGFP-----SHDVVKRRPVNCNTTHYRANW 648 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/56 (46%), Positives = 29/56 (51%) Frame = -3 Query: 932 HSPFXGANFWKGPSXRAFFVITPXCXKGDLLQGGLSWXNPQVFPSHDVVKTTGPVN 765 HSPF N W+G S RA ++ KG LSW FPSHDVVK PVN Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLA-KGGCAARRLSWG----FPSHDVVKRR-PVN 638 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/50 (46%), Positives = 25/50 (50%) Frame = -2 Query: 885 GLFRYYPXLXKGGFAARRIKLG*PPGFSQSRRCKNDRPSELNTTHYRANW 736 GLF P + G + IKLG GF K RP NTTHYRANW Sbjct: 12 GLFAITPA-GERGMCCKAIKLGNAKGFPSHDVVKR-RPVNCNTTHYRANW 59 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = -2 Query: 861 LXKGGFAARRIKLG*PPGFSQSRRCKNDRPSELNTTHYRANW 736 L KGG AARR+ G P S RP NTTHYRANW Sbjct: 55 LAKGGCAARRLSWGFP-----SHDVVKRRPVNCNTTHYRANW 91 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/56 (46%), Positives = 29/56 (51%) Frame = -3 Query: 932 HSPFXGANFWKGPSXRAFFVITPXCXKGDLLQGGLSWXNPQVFPSHDVVKTTGPVN 765 HSPF N W+G S RA ++ KG LSW FPSHDVVK PVN Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLA-KGGCAARRLSWG----FPSHDVVKRR-PVN 81 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = -2 Query: 861 LXKGGFAARRIKLG*PPGFSQSRRCKNDRPSELNTTHYRANW 736 L KGG AARR+ G P S RP NTTHYRANW Sbjct: 55 LAKGGCAARRLSWGFP-----SHDVVKRRPVNCNTTHYRANW 91 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/56 (46%), Positives = 29/56 (51%) Frame = -3 Query: 932 HSPFXGANFWKGPSXRAFFVITPXCXKGDLLQGGLSWXNPQVFPSHDVVKTTGPVN 765 HSPF N W+G S RA ++ KG LSW FPSHDVVK PVN Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLA-KGGCAARRLSWG----FPSHDVVKRR-PVN 81 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 39.5 bits (88), Expect = 0.004 Identities = 30/71 (42%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Frame = -2 Query: 933 PFPISRGQFLE-RXIXAG-LFRYYPXLXKGGFAARRIKLG*PPGFSQSRRCKNDRPSELN 760 PF I Q E R + A L R L KGG AARR+ PGFSQSRRCK ++L Sbjct: 11 PFAIQAAQLWEGRSVRASSLLRQ---LAKGGCAARRLSWV-TPGFSQSRRCKTTASAKLA 66 Query: 759 TTHYRANWXPG 727 + PG Sbjct: 67 CLQVDSRGSPG 77 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.5 bits (88), Expect = 0.004 Identities = 25/65 (38%), Positives = 31/65 (47%) Frame = +1 Query: 739 IRPIVSRIQFTGPVVFTTS*LGKTWGLXQLNPPCSKSPFXQXGVITKKARXDGPFQKLAP 918 +RP+VSRI + GKT L L P GVI ++AR D P Q+L Sbjct: 33 LRPVVSRITIHWTSFYNVV-TGKTLALPNLIA-LQHIPLSPAGVIAEEARTDRPSQQLRS 90 Query: 919 XNGEW 933 NGEW Sbjct: 91 LNGEW 95 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 41 QFALYESYYNSLA-GVLQRRDWENP-GVTQLNRLAAHPP 77 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/53 (45%), Positives = 26/53 (49%) Frame = -2 Query: 894 IXAGLFRYYPXLXKGGFAARRIKLG*PPGFSQSRRCKNDRPSELNTTHYRANW 736 I AGLF P + G + IKLG F K RP NTTHYRANW Sbjct: 3 IGAGLFAITPA-GERGMCCKAIKLGNASVFPSHDVVKR-RPVNCNTTHYRANW 53 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-GVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPPXXXXG 868 QFAL +NSL LQRRDWE P G L RLAA+PP G Sbjct: 41 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPPFTSWG 82 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/40 (52%), Positives = 25/40 (62%) Frame = +3 Query: 762 SIHWAGRFYNVVTGKNLGVXPT*SALQQIPLXAXWGNNEK 881 +IHW FYNVVTGK L + P ALQ P A W N+E+ Sbjct: 5 TIHWPS-FYNVVTGKTLAL-PNLIALQLHPPFASWRNSEE 42 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 24 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 60 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 25 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 61 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 51 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 87 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 27 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 63 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 59 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 95 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 35 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 71 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 42 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 78 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 58 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 94 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 46 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 82 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 72 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 108 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 92 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 128 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 132 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 168 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 49 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 85 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 23 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 59 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 62 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 98 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 45 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 81 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 58 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 94 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 39 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 75 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 26 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 62 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 90 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 126 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 47 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 83 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 34 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 70 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 43 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 79 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 25 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 61 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 44 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 80 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 57 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 93 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 100 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 136 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 56 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 92 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 38 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 74 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +1 Query: 814 GLXQLNPPCSKSPFXQXGVITKKARXDGPFQKLAPXNGEW 933 G+ QLN + PF +KAR D P Q+L NGEW Sbjct: 62 GVTQLNRLAAHPPFASWRN-NEKARTDRPSQQLRSLNGEW 100 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 150 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 186 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 41 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 77 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 31 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 67 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 23 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 59 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 30 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 66 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 98 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 134 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 47 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 83 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 25 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 61 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 84 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 120 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 32 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 68 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 27 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 63 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 136 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 172 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 44 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 80 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 46 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 82 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 27 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 63 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 31 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 67 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 45 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 81 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 39 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 75 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 115 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 151 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 157 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 193 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 25 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 61 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 72 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 108 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 46 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 82 >SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 30 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 66 >SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) Length = 180 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 78 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 114 >SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 452 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 488 >SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 43 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 79 >SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 28 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 64 >SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 23 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 59 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 91 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 127 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 56 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 92 >SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 78 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 114 >SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 36 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 72 >SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 27 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 63 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 59 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 95 >SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 61 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 97 >SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 36 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 72 >SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 123 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 159 >SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 169 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 205 >SB_34190| Best HMM Match : MAM (HMM E-Value=0) Length = 384 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 66 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 102 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 42 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 78 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) Length = 331 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 229 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 265 >SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 99 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 135 >SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 34 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 70 >SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 34 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 70 >SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 26 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 62 >SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 76 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 112 >SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 66 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 102 >SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 51 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 87 >SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) Length = 163 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 61 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 97 >SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 25 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 61 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 58 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 94 >SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) Length = 204 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 102 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 138 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 27 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 63 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 41 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 77 >SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 29 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 65 >SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 126 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 162 >SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 25 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 61 >SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 31 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 67 >SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) Length = 163 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 61 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 97 >SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) Length = 504 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 132 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 168 >SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 47 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 83 >SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) Length = 195 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 93 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 129 >SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) Length = 261 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 159 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 195 >SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) Length = 136 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 35 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 71 >SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) Length = 169 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 67 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 103 >SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 112 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 148 >SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 26 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 62 >SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) Length = 460 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 249 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 285 Score = 35.1 bits (77), Expect = 0.088 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +2 Query: 761 FNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 +NSL LQRRDWE P G L RLAA+PP Sbjct: 366 YNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 394 >SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 80 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 116 >SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 35 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 71 >SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 37 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 73 >SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 39 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 75 >SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 117 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 153 >SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 63 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 99 >SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 38 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 74 >SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 32 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 68 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 63 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 99 >SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 85 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 121 >SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 84 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 120 >SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 40 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 76 >SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 32 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 68 >SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 62 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 98 >SB_16189| Best HMM Match : rve (HMM E-Value=0.3) Length = 595 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 493 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 529 >SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 47 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 83 >SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) Length = 791 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 27 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 63 >SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 118 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 154 >SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 43 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 79 >SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 77 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 113 >SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 47 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 83 >SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 38 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 74 >SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 42 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 78 >SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) Length = 177 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 75 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 111 >SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 93 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 129 >SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 76 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 112 >SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) Length = 160 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 58 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 94 >SB_12355| Best HMM Match : IncA (HMM E-Value=2) Length = 225 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 123 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 159 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 55 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 91 >SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 33 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 69 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 39 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 75 >SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 23 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 59 >SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 30 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 66 >SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 25 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 61 >SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 23 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 59 >SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) Length = 271 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 169 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 205 >SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 23 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 59 >SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 97 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 133 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 250 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 286 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 26 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 62 >SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 41 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 77 >SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 53 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 89 >SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 27 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 63 >SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 46 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 82 >SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 111 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 147 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 43 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 79 >SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 35 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 71 >SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 55 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 91 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 58 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 94 >SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 34 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 70 >SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 89 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 125 >SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 55 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 91 >SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 81 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 117 >SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) Length = 188 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 48 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 84 >SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 38 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 74 >SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 32 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 68 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 59 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 95 >SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 29 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 65 >SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 379 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 48 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 84 >SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 31 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 67 >SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 67 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 103 >SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 33 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 69 >SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 31 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 67 >SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 39 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 75 >SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 121 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 157 >SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 39 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 75 >SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 36 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 72 >SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 24 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 60 >SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 45 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 81 >SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 42 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 78 >SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 59 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 95 >SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 96 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 132 >SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 28 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 64 >SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 24 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 60 >SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 25 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 61 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 51 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 87 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 47 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 83 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +1 Query: 814 GLXQLNPPCSKSPFXQXGVITKKARXDGPFQKLAPXNGEW 933 G+ QLN + PF ++KAR D P Q+L NGEW Sbjct: 71 GVTQLNRLAAHPPFASWRN-SEKARTDRPSQQLRSLNGEW 109 >SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) Length = 174 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 72 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 108 >SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 30 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 66 >SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 23 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 59 >SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 34 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 70 >SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 86 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 122 >SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 65 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 101 >SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 277 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 313 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 43 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 79 >SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) Length = 216 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 55 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 91 >SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 72 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 108 >SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 31 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 67 >SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 68 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 104 >SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 35 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 71 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 54 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 90 >SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 59 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 95 >SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 23 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 59 >SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 43 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 79 >SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 25 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 61 >SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 51 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 87 >SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 737 QFAL**VVFNSLGRSFLQRRDWEKPGGXPNLIRLAANPP 853 QFAL +NSL LQRRDWE P G L RLAA+PP Sbjct: 39 QFALYESYYNSLA-VVLQRRDWENP-GVTQLNRLAAHPP 75 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,578,224 Number of Sequences: 59808 Number of extensions: 644820 Number of successful extensions: 6232 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4010 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6193 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2907797044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -