BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0274.Seq (832 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.2 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 22 5.2 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 22 5.2 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 22 5.2 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 21 9.1 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 21 9.1 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/52 (19%), Positives = 19/52 (36%) Frame = +3 Query: 402 IHWPSFYNVVNWENPGVTQLNRLAAXPPFASWRNSEXPAPIALPNSCAPEWR 557 +HW + +W + + P +SW+ P+ P S W+ Sbjct: 1135 LHWNKERKICDWPKSAKCEEKKPGHKPSTSSWQKPTKPS--YRPPSTTNHWQ 1184 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -2 Query: 321 SFAPSSSSILNND*YNVNNRITN 253 S +PSS++++ N+ N N+R +N Sbjct: 331 SNSPSSTNLIQNEASNENSRESN 353 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -2 Query: 321 SFAPSSSSILNND*YNVNNRITN 253 S +PSS++++ N+ N N+R +N Sbjct: 120 SNSPSSTNLIQNEASNENSRESN 142 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -2 Query: 321 SFAPSSSSILNND*YNVNNRITN 253 S +PSS++++ N+ N N+R +N Sbjct: 120 SNSPSSTNLIQNEASNENSRESN 142 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 737 PRFFNSGLLFQTGTTLNP 684 P F +SG++ GT L P Sbjct: 70 PEFVHSGMVHNDGTQLMP 87 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 737 PRFFNSGLLFQTGTTLNP 684 P F +SG++ GT L P Sbjct: 70 PEFVHSGMVHNDGTQLMP 87 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,086 Number of Sequences: 336 Number of extensions: 3322 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22829180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -