BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0274.Seq (832 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 3e-28 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 4e-22 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 100 1e-21 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 97 2e-20 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 92 4e-19 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 9e-18 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 3e-15 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 3e-15 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 78 8e-15 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 8e-15 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 73 2e-13 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 66 2e-11 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 63 2e-10 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 63 3e-10 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 62 4e-10 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 62 5e-10 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 62 7e-10 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 62 7e-10 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 62 7e-10 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 60 2e-09 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 60 2e-09 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 60 3e-09 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 60 3e-09 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 60 3e-09 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 60 3e-09 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 60 3e-09 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 60 3e-09 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 60 3e-09 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 60 3e-09 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 60 3e-09 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 60 3e-09 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 60 3e-09 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 60 3e-09 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 60 3e-09 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 60 3e-09 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 60 3e-09 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 60 3e-09 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 60 3e-09 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 60 3e-09 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 60 3e-09 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 60 3e-09 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 60 3e-09 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 60 3e-09 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 60 3e-09 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 60 3e-09 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 60 3e-09 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 60 3e-09 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 60 3e-09 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 60 3e-09 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 60 3e-09 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 60 3e-09 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 60 3e-09 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 60 3e-09 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 60 3e-09 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 60 3e-09 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 60 3e-09 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 60 3e-09 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 60 3e-09 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 60 3e-09 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 60 3e-09 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 60 3e-09 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 60 3e-09 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 60 3e-09 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 60 3e-09 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 60 3e-09 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 60 3e-09 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 60 3e-09 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 60 3e-09 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 60 3e-09 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 60 3e-09 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 60 3e-09 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 60 3e-09 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 60 3e-09 SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) 59 4e-09 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 5e-09 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 5e-09 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 59 5e-09 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 5e-09 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 59 5e-09 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 58 7e-09 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 58 7e-09 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 58 7e-09 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 58 7e-09 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 58 7e-09 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 58 7e-09 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 58 7e-09 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 58 7e-09 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 58 7e-09 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 58 7e-09 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 58 7e-09 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 58 7e-09 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 58 7e-09 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 58 7e-09 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 58 7e-09 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 58 7e-09 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 58 7e-09 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 58 7e-09 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 58 7e-09 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 58 7e-09 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 58 7e-09 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 58 7e-09 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 58 7e-09 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 58 7e-09 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 58 7e-09 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 58 7e-09 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 58 7e-09 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 58 7e-09 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 58 7e-09 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 58 7e-09 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 122 bits (295), Expect = 3e-28 Identities = 52/58 (89%), Positives = 53/58 (91%) Frame = -3 Query: 545 CATVGKGDRCGXLAITPAGERGXCCKAIKLGNARVFPVHDVVKRRPVNCNTTHYRANW 372 CATVGKGDRCG AITPAGERG CCKAIKLGNA+ FP HDVVKRRPVNCNTTHYRANW Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 102 bits (244), Expect = 4e-22 Identities = 44/55 (80%), Positives = 46/55 (83%) Frame = -3 Query: 536 VGKGDRCGXLAITPAGERGXCCKAIKLGNARVFPVHDVVKRRPVNCNTTHYRANW 372 +G+ G AITPAGERG CCKAIKLGNA VFP HDVVKRRPVNCNTTHYRANW Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -1 Query: 574 RLQFAIRHSGAQLLGRAIGAGXSLLRQLAKGGXAARRL 461 R+ FAI+ AQLLGRAIGAG + + G + + Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 100 bits (240), Expect = 1e-21 Identities = 43/48 (89%), Positives = 43/48 (89%) Frame = -3 Query: 515 GXLAITPAGERGXCCKAIKLGNARVFPVHDVVKRRPVNCNTTHYRANW 372 G AITPAGERG CCKAIKLGNA VFP HDVVKRRPVNCNTTHYRANW Sbjct: 6 GLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 96.7 bits (230), Expect = 2e-20 Identities = 41/55 (74%), Positives = 45/55 (81%) Frame = -3 Query: 536 VGKGDRCGXLAITPAGERGXCCKAIKLGNARVFPVHDVVKRRPVNCNTTHYRANW 372 +G+ G AITPAGERG CCK+IKL +A VFP HDVVKRRPVNCNTTHYRANW Sbjct: 7 LGRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 92.3 bits (219), Expect = 4e-19 Identities = 41/54 (75%), Positives = 43/54 (79%) Frame = -3 Query: 536 VGKGDRCGXLAITPAGERGXCCKAIKLGNARVFPVHDVVKRRPVNCNTTHYRAN 375 +G+ G AITPAGERG CCKAIKLGNAR FP HD KRRPVNCNTTHYRAN Sbjct: 44 LGRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 90.2 bits (214), Expect = 2e-18 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +3 Query: 390 SRITIHWPSFYNVVNWENPGVTQLNRLAAXPPFASWRNSE 509 SRITIHWPSFYNVV+WENPGVTQLNRLAA PPFASWRNSE Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSE 41 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 90.2 bits (214), Expect = 2e-18 Identities = 41/55 (74%), Positives = 43/55 (78%) Frame = -3 Query: 536 VGKGDRCGXLAITPAGERGXCCKAIKLGNARVFPVHDVVKRRPVNCNTTHYRANW 372 +G+ G AITPAGERG CCKAIKL VFP HDVVKRRPVNCNTTHYRANW Sbjct: 1846 LGRAIGAGLFAITPAGERGMCCKAIKLVTP-VFPSHDVVKRRPVNCNTTHYRANW 1899 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/45 (44%), Positives = 26/45 (57%) Frame = -1 Query: 574 RLQFAIRHSGAQLLGRAIGAGXSLLRQLAKGGXAARRLSWVTPGF 440 R+ FAI+ AQLLGRAIGAG + + G + + VTP F Sbjct: 1835 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVTPVF 1877 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 87.8 bits (208), Expect = 9e-18 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = +3 Query: 375 IRPIVSRITIHWPSFYNVVNWENPGVTQLNRLAAXPPFASWRNSE 509 IRPIVSRITIHWPSFY +WENPGV QLNRLAA PPFASWR+SE Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSE 62 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +3 Query: 390 SRITIHWPSFYNVVNWENPGVTQLNRLAAXPPFASWRNSE 509 SRITIHWPSFYNVV +NPGVTQLNRLAA PPFASWRNSE Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSE 41 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 79.8 bits (188), Expect = 3e-15 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +3 Query: 390 SRITIHWPSFYNVVNWENPGVTQLNRLAAXPPFASWRNSE 509 SRITIHWPSFYNVV +N GVTQLNRLAA PPFASWRNSE Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSE 41 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 79.8 bits (188), Expect = 3e-15 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +3 Query: 390 SRITIHWPSFYNVVNWENPGVTQLNRLAAXPPFASWRNSE 509 SRITIHWPSFYNVV +N GVTQLNRLAA PPFASWRNSE Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSE 41 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 78.6 bits (185), Expect = 6e-15 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -3 Query: 488 ERGXCCKAIKLGNARVFPVHDVVKRRPVNCNTTHYRAN 375 ERG CCKAIKLGNA VF HDVVKRRPVNCNTTHYRAN Sbjct: 3 ERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 78.2 bits (184), Expect = 8e-15 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +3 Query: 372 PIRPIVSRITIHWPSFYNVVNWENPGVTQLNRLAAXPPFASWRNSE 509 PIRPIVSRITIHWP+FYN + TQLNRLAA PPFASWRNS+ Sbjct: 39 PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQ 84 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 78.2 bits (184), Expect = 8e-15 Identities = 35/56 (62%), Positives = 41/56 (73%), Gaps = 1/56 (1%) Frame = -3 Query: 536 VGKGDRCGXLAITPAGERGXCCKA-IKLGNARVFPVHDVVKRRPVNCNTTHYRANW 372 +G+ G AITPAGE+G + +KLG + FP HDVVKRRPVNCNTTHYRANW Sbjct: 47 LGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 77.8 bits (183), Expect = 1e-14 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +3 Query: 390 SRITIHWPSFYNVVNWENPGVTQLNRLAAXPPFASWRNSE 509 SRITIHWPSFYNV+ + PGVTQLNRLAA PPFASWRNSE Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSE 41 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 76.6 bits (180), Expect = 2e-14 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +3 Query: 387 VSRITIHWPSFYNVVNWENPGVTQLNRLAAXPPFASWRNSE 509 +SRITIHWPS +WENPGVTQLNRLAA PPFASWRNSE Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 317 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/44 (43%), Positives = 22/44 (50%) Frame = +2 Query: 416 VLQRRELGKPWRYPT*SPCSXSPFRQLA**RXARTDRPSQQLRT 547 VLQRR+ P + PF ARTDRPSQQLR+ Sbjct: 287 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 330 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 74.1 bits (174), Expect = 1e-13 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +3 Query: 390 SRITIHWPSFYNVVNWENPGVTQLNRLAAXPPFASWRNSE 509 SRITIHWPSFYNVV + VTQLNRLAA PPFASWRNSE Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSE 41 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 73.3 bits (172), Expect = 2e-13 Identities = 36/69 (52%), Positives = 41/69 (59%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSEXPAPIALPNSCAPEWRMANCKR*YFVKIRVKFLL 611 +WENPGVTQLNRLAA PPFASWRNSE P P PEWRM + YF+ + Sbjct: 352 DWENPGVTQLNRLAAHPPFASWRNSERPHRSPFPTVAQPEWRMGLMR--YFLLTHLLIRP 409 Query: 612 NQLIF*PIG 638 IF +G Sbjct: 410 FMFIFFQVG 418 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.9 bits (161), Expect = 5e-12 Identities = 34/55 (61%), Positives = 36/55 (65%), Gaps = 3/55 (5%) Frame = +3 Query: 405 HWPSFYNVVNWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 HWPSFYNVV + GVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 59 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 68.5 bits (160), Expect = 6e-12 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -3 Query: 509 LAITPAGERGXCCKAIKLGNARVFPVHDVVKRRPVNCNTTHYRANW 372 LA TP+G++ ++ +A VFP HDVVKRRPVNCNTTHYRANW Sbjct: 14 LATTPSGDKSMYSESNNKSHAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 66.5 bits (155), Expect = 2e-11 Identities = 32/58 (55%), Positives = 37/58 (63%), Gaps = 3/58 (5%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRMANCKR*YFVKIR 596 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ C + Y ++R Sbjct: 61 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCGQNYTTRLR 118 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 63.3 bits (147), Expect = 2e-10 Identities = 30/51 (58%), Positives = 33/51 (64%), Gaps = 3/51 (5%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRMANCKR 575 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ C + Sbjct: 178 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCDK 228 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 63.3 bits (147), Expect = 2e-10 Identities = 34/57 (59%), Positives = 37/57 (64%), Gaps = 7/57 (12%) Frame = +3 Query: 360 GARYPIRPIVSRITIHWPSFYNVV-------NWENPGVTQLNRLAAXPPFASWRNSE 509 G YP P SR H S+YN + +WENPGVTQLNRLAA PPFASWRNSE Sbjct: 42 GLNYPFVPKSSR---HSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 95 Score = 35.5 bits (78), Expect = 0.053 Identities = 22/47 (46%), Positives = 25/47 (53%) Frame = +2 Query: 407 LAVVLQRRELGKPWRYPT*SPCSXSPFRQLA**RXARTDRPSQQLRT 547 LAVVLQRR+ P + PF ARTDRPSQQLR+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 108 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 62.9 bits (146), Expect = 3e-10 Identities = 31/51 (60%), Positives = 33/51 (64%), Gaps = 3/51 (5%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRMANCKR 575 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ KR Sbjct: 59 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRTKR 109 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 62.5 bits (145), Expect = 4e-10 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 390 SRITIHWPSFYNVVNWENPGVTQLNRLAAXPPFASWRNSE 509 SRITIHWPSFYNVV + + L LAA PPFASWRNSE Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSE 41 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/54 (57%), Positives = 34/54 (62%), Gaps = 3/54 (5%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRMANCKR*YF 584 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ R Y+ Sbjct: 199 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYMRDYY 252 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 62.1 bits (144), Expect = 5e-10 Identities = 29/43 (67%), Positives = 33/43 (76%), Gaps = 7/43 (16%) Frame = +3 Query: 402 IHWPSFYNVV-------NWENPGVTQLNRLAAXPPFASWRNSE 509 IH+ S+YN + +WENPGVTQLNRLAA PPFASWRNSE Sbjct: 1464 IHYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 1506 Score = 35.5 bits (78), Expect = 0.053 Identities = 22/47 (46%), Positives = 25/47 (53%) Frame = +2 Query: 407 LAVVLQRRELGKPWRYPT*SPCSXSPFRQLA**RXARTDRPSQQLRT 547 LAVVLQRR+ P + PF ARTDRPSQQLR+ Sbjct: 1473 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 1519 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 61.7 bits (143), Expect = 7e-10 Identities = 32/63 (50%), Positives = 37/63 (58%) Frame = -3 Query: 560 HSPFRCATVGKGDRCGXLAITPAGERGXCCKAIKLGNARVFPVHDVVKRRPVNCNTTHYR 381 HSPFR +G ++ +G C A +L FP HDVVKRRPVNCNTTHYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCA-ARRLSWG--FPSHDVVKRRPVNCNTTHYR 645 Query: 380 ANW 372 ANW Sbjct: 646 ANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 61.7 bits (143), Expect = 7e-10 Identities = 32/63 (50%), Positives = 37/63 (58%) Frame = -3 Query: 560 HSPFRCATVGKGDRCGXLAITPAGERGXCCKAIKLGNARVFPVHDVVKRRPVNCNTTHYR 381 HSPFR +G ++ +G C A +L FP HDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCA-ARRLSWG--FPSHDVVKRRPVNCNTTHYR 88 Query: 380 ANW 372 ANW Sbjct: 89 ANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 61.7 bits (143), Expect = 7e-10 Identities = 32/63 (50%), Positives = 37/63 (58%) Frame = -3 Query: 560 HSPFRCATVGKGDRCGXLAITPAGERGXCCKAIKLGNARVFPVHDVVKRRPVNCNTTHYR 381 HSPFR +G ++ +G C A +L FP HDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCA-ARRLSWG--FPSHDVVKRRPVNCNTTHYR 88 Query: 380 ANW 372 ANW Sbjct: 89 ANW 91 >SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/38 (71%), Positives = 29/38 (76%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSEXPAPIALPNSCA 545 +WENPGVTQLNRLAA PPFASWRNSE +SCA Sbjct: 62 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSHSCA 99 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 60.9 bits (141), Expect = 1e-09 Identities = 28/46 (60%), Positives = 35/46 (76%), Gaps = 3/46 (6%) Frame = +3 Query: 381 PIVSRITIHWPSFYNVV---NWENPGVTQLNRLAAXPPFASWRNSE 509 P++ R+ ++ S V+ +WENPGVTQLNRLAA PPFASWRNSE Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 95 Score = 35.5 bits (78), Expect = 0.053 Identities = 22/47 (46%), Positives = 25/47 (53%) Frame = +2 Query: 407 LAVVLQRRELGKPWRYPT*SPCSXSPFRQLA**RXARTDRPSQQLRT 547 LAVVLQRR+ P + PF ARTDRPSQQLR+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 108 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 60.5 bits (140), Expect = 2e-09 Identities = 30/51 (58%), Positives = 33/51 (64%), Gaps = 3/51 (5%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRMANCKR 575 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ +R Sbjct: 206 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRPQR 256 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 60.1 bits (139), Expect = 2e-09 Identities = 29/50 (58%), Positives = 32/50 (64%), Gaps = 3/50 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRMANCK 572 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ + Sbjct: 537 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRAR 586 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 23 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 70 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 33 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 48 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 57 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 36 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 24 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 37 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 82 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 26 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 24 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 841 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 886 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 24 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 122 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 167 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 47 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 28 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 19 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 27 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 96 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 45 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 140 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 185 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 30 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 161 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 206 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 65 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 29 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 55 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 68 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 24 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 221 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 266 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 41 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 56 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 48 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 83 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 128 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 30 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 65 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 108 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 81 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 36 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 154 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 67 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 96 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 108 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 1198 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1243 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -1 Query: 532 GRAIGAGXSLLRQLAKGGXAARRLSW 455 GR++ A SLLRQLAKGG AARRLSW Sbjct: 415 GRSVRAS-SLLRQLAKGGCAARRLSW 439 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = -2 Query: 573 AYNLPFAIQVRNCWEGRSVRASRYYASWRKG 481 A + PF ++RNCWEGRSVRAS KG Sbjct: 402 ASHSPF--RLRNCWEGRSVRASSLLRQLAKG 430 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 40 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 133 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 178 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 85 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 130 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 39 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 24 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 42 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 44 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 104 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 149 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 69 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 92 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 48 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 92 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 92 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 29 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 73 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 32 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 116 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 24 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 32 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 51 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 84 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 129 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 75 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 120 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 99 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 144 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 49 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 1071 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1116 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 25 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 39 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 142 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 187 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 190 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 235 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 67 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 43 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 88 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 27 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 154 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 66 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 124 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 169 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 31 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 76 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 660 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 705 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 47 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 169 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 214 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 55 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 40 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 30 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 66 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 78 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 25 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 68 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 465 RLAAXPPFASWRNSE 509 +++A PPFASWRNSE Sbjct: 14 QVSAHPPFASWRNSE 28 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 79 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 87 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 193 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 238 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 452 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 497 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 81 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 274 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 319 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 28 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 42 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 69 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 78 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 112 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 71 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 81 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 81 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 25 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 33 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 82 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 127 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 53 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 98 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 91 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 184 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 229 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 39 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 91 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 28 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 57 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 81 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 150 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 195 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 76 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 121 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 65 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 77 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 28 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 24 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 46 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 52 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 70 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 89 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 95 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 140 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 112 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 46 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 58 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 103 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 57 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 49 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 30 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 28 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 134 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 51 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 77 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 63 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 26 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 62 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 107 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 96 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 63 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 66 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 28 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 102 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 147 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 73 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 175 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 220 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 70 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 50 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 95 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 25 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 41 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 87 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 65 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 42 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 113 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 158 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 54 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 99 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 44 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 127 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 172 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 160 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 205 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 110 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 155 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 42 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 34 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 63 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 45 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 64 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 164 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 209 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 35 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 80 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 77 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 134 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 66 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 97 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 142 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 26 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 34 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 79 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 93 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 138 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 52 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 101 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 153 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 198 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 80 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 799 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 844 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 80 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 101 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 63 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 115 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 160 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 24 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 89 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 116 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 24 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 314 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 359 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 38 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 83 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 60 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 105 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 23 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 34 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 24 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 64 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 255 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 300 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 89 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 42 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 56 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 24 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 32 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 212 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 257 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 71 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 26 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 43 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 88 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 727 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 772 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 47 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 45 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 24 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 195 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 240 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 24 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 123 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 168 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 38 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 83 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 28 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 93 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 138 >SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 19 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 40 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 117 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 162 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +3 Query: 432 NWENPGVTQLNRLAAXPPFASWRNSE---XPAPIALPNSCAPEWRM 560 +WENPGVTQLNRLAA PPFASWRNSE P S EWR+ Sbjct: 29 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,927,113 Number of Sequences: 59808 Number of extensions: 420811 Number of successful extensions: 9027 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8396 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2335516755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -