BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0273.Seq (922 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043698-5|AAL65782.1| 104|Caenorhabditis elegans Saposin-like ... 32 0.66 AL032618-2|CAA21485.1| 640|Caenorhabditis elegans Hypothetical ... 30 2.0 >AF043698-5|AAL65782.1| 104|Caenorhabditis elegans Saposin-like protein family protein17 protein. Length = 104 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/66 (24%), Positives = 30/66 (45%) Frame = -3 Query: 476 PPADSSICVLTCLARSMGRTSRSLT*ASILNTANSSASCIHEVFSNSVRHCVRRYARSPS 297 PP+ +++ +TC+A G ++ L + + A C+ EV ++S H Y Sbjct: 22 PPSQATLACITCVATVKGVEAKMLHEGGNVAKHDVDAICLKEVPTHSAEHLCEEYGEHEV 81 Query: 296 KLMXAL 279 +M L Sbjct: 82 DVMVTL 87 >AL032618-2|CAA21485.1| 640|Caenorhabditis elegans Hypothetical protein Y42A5A.2 protein. Length = 640 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 237 SAACRPPVPYLLRVQRLHELAGTPGVPPHT 326 S C P PYLL V+ +H L + G PHT Sbjct: 403 SDVCSPCHPYLLHVRIIHLLEHSSGAWPHT 432 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,763,330 Number of Sequences: 27780 Number of extensions: 337591 Number of successful extensions: 844 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 844 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2360254050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -