BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0272.Seq (904 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 27 1.0 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 26 1.8 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 24 5.5 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 26.6 bits (56), Expect = 1.0 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 878 TXXSTRTPAPGPQV---RGHPXLXFAPPPMIXXSTDASPEFS 762 T STR P+PGP V A PP I S+ P++S Sbjct: 435 TVRSTRAPSPGPIVYYPARETLPRLAQPPTITRSSSMFPDWS 476 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.8 bits (54), Expect = 1.8 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = +1 Query: 778 ASVDXXIIGGGANXSXGCPRTCGPGAGVRVXFXVNGPGH 894 AS+ +GGG+ G + G G G+ G GH Sbjct: 669 ASLGGGAVGGGSGAGGGAGSSGGSGGGLASGSPYGGGGH 707 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 24.2 bits (50), Expect = 5.5 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 569 STPYPAFVSHFLGGQDSGLMLHLTAELARQMGQKNLR 679 ST P F +HFLG Q + H+ ++ Q+ L+ Sbjct: 538 STTAPIFHTHFLGYQPQMQLPHVEPFYRKEQQQQQLQ 574 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 910,802 Number of Sequences: 2352 Number of extensions: 18323 Number of successful extensions: 125 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97574436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -