BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0268.Seq (886 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55463| Best HMM Match : OPA3 (HMM E-Value=0) 52 5e-07 SB_30343| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14227| Best HMM Match : Cofilin_ADF (HMM E-Value=0.0013) 47 2e-05 SB_28028| Best HMM Match : Cofilin_ADF (HMM E-Value=2e-20) 37 0.025 SB_35589| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.058 SB_7256| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_11461| Best HMM Match : NHL (HMM E-Value=0) 31 1.2 SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_27884| Best HMM Match : Pox_A32 (HMM E-Value=0.61) 30 2.2 SB_44786| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_46293| Best HMM Match : Keratin_B2 (HMM E-Value=0.00077) 28 8.7 SB_3680| Best HMM Match : Keratin_B2 (HMM E-Value=0.0024) 28 8.7 >SB_55463| Best HMM Match : OPA3 (HMM E-Value=0) Length = 387 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/62 (35%), Positives = 40/62 (64%) Frame = +3 Query: 300 EASKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEK 479 E + + KL L+ WCPD ++K +M+ +++F +KK G K ++ + SE S EA++E+ Sbjct: 323 EGADRSKLVLIFWCPDNCEIKSRMVSAATFQDVKKKCPGGAKCLEIQERSELSFEALKEE 382 Query: 480 LR 485 L+ Sbjct: 383 LK 384 >SB_30343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 50.4 bits (115), Expect = 2e-06 Identities = 22/62 (35%), Positives = 38/62 (61%) Frame = +3 Query: 300 EASKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEK 479 E +++ KL L+ WCPD +K KM+ +++F + K G K ++ D + S EA++EK Sbjct: 76 EGAERSKLVLIFWCPDNCGIKNKMVSAATFKEVMKKCPGGAKCLEIQDRFDLSFEALKEK 135 Query: 480 LR 485 L+ Sbjct: 136 LK 137 >SB_14227| Best HMM Match : Cofilin_ADF (HMM E-Value=0.0013) Length = 310 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/58 (37%), Positives = 33/58 (56%) Frame = +3 Query: 279 HQCQGTSEASKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSE 452 H+ Q A FL C D A +KKKML S+++ LKK G++KY +A+++ E Sbjct: 241 HKTQDHRSALSDLVFFLFDRCSDEAPIKKKMLAGSTWEYLKKKFDGLKKYFEASEICE 298 >SB_28028| Best HMM Match : Cofilin_ADF (HMM E-Value=2e-20) Length = 151 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = +3 Query: 321 LFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEKLRAT 491 L +SWC D A ++KKM +S+ D ++K + A D + + + K T Sbjct: 93 LVFISWCSDKAPIEKKMKLASTQDYVRKKFSEATTSVNANDFDDLDYDEIAAKAEKT 149 >SB_35589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/53 (30%), Positives = 31/53 (58%) Frame = +3 Query: 321 LFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEK 479 L + WC D A +KK+M+ +++ + LK V V+K Q D ++ + + + +K Sbjct: 93 LVYIFWCSDNAPIKKRMVSAATNELLKTKFV-VKKVFQINDRADLNYDDIADK 144 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 11/65 (16%) Frame = +1 Query: 64 SGVTVSDACKTTYEEIK-KDKKHRYVVFYIRDE----------KQIDVETVGERNAEYEQ 210 SG+ + D Y+ ++ K+K H++ F I D+ K++D T E A ++Q Sbjct: 4 SGIKIDDESLHLYQTMQGKEKSHKFATFKISDDGKMVVIDHILKRVDTHTREEDRAIFDQ 63 Query: 211 FLEDL 225 LE L Sbjct: 64 MLEKL 68 >SB_7256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 4/36 (11%) Frame = +2 Query: 452 SVSGGRRREAPRHRSPINSFTH----ELATKPNPLS 547 + +GGRRRE P R+P+ F E A KP+P++ Sbjct: 45 AAAGGRRREGPTARAPVGGFAEVGNAEFAEKPSPIT 80 >SB_11461| Best HMM Match : NHL (HMM E-Value=0) Length = 819 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = +2 Query: 500 INSFTHELA--TKPNPLSDTPALTTRGHDTTSRLVLLQRKTNSINMIDF 640 + + T EL+ T+ NPL TPAL++RG T R+ + + N+ IDF Sbjct: 292 LENLTQELSDTTRLNPL--TPALSSRGQRGTPRIPYRESQQNAEGNIDF 338 >SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 31.1 bits (67), Expect = 1.2 Identities = 23/74 (31%), Positives = 27/74 (36%), Gaps = 2/74 (2%) Frame = +2 Query: 476 EAPRHRSPINSF-THELATKPNPLSDTPALTTRGHDTTSRLVLLQRKT-NSINMIDFTGG 649 E RH + ++ THE L DT T HDTT L T N + D TG Sbjct: 502 ETTRHDTHLHDMHTHETTRHDTHLHDTTENDTHPHDTTGNDTYLHDTTENDTHPHDTTGN 561 Query: 650 RTSCESARVGTTAP 691 T T P Sbjct: 562 DTQLHDTTGNKTRP 575 >SB_27884| Best HMM Match : Pox_A32 (HMM E-Value=0.61) Length = 1226 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/52 (34%), Positives = 21/52 (40%) Frame = -2 Query: 489 WRGASLRRPPETLPRGRSLGCTSELRQGTFSERRXXXXXXXXX*PWRCPGTT 334 W G + R PP RS+ TS L TF ERR W P T+ Sbjct: 855 WGGTAERPPPRQSAPSRSMAITSLLCGSTF-ERRTTVLSMGVVSDWSIPATS 905 >SB_44786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +2 Query: 413 RSSEVHPSDRPLGSVSGGRRREAPRHRSPINSFTHELATKPNPLSDTPALTTR 571 R E+ +R L + +RRE R+ N HE T+ S T A TR Sbjct: 519 RKDEIEEQNRTLRQLMEEKRREIEGLRAEANQLRHESKTREERESSTIAALTR 571 >SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2480 Score = 28.7 bits (61), Expect = 6.6 Identities = 19/56 (33%), Positives = 22/56 (39%) Frame = -2 Query: 483 GASLRRPPETLPRGRSLGCTSELRQGTFSERRXXXXXXXXX*PWRCPGTTTSGRAS 316 G + R PP R + TS L TF ERR W P T +G AS Sbjct: 651 GTAERLPPRQSAPSRFMAITSLLCGSTF-ERRTTVLSMGVVSDWSVPATRCAGTAS 705 >SB_46293| Best HMM Match : Keratin_B2 (HMM E-Value=0.00077) Length = 677 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = -3 Query: 749 NGCPAFQTETHYCFTAEIGRGRWYLPART 663 N C ++T+ ++C T++I + WY P +T Sbjct: 190 NWCHPYKTQANWCHTSKI-QSNWYHPNKT 217 >SB_3680| Best HMM Match : Keratin_B2 (HMM E-Value=0.0024) Length = 180 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = -3 Query: 749 NGCPAFQTETHYCFTAEIGRGRWYLPART 663 N C ++T+ ++C T++I + WY P +T Sbjct: 35 NWCHPYKTQANWCHTSKI-QSNWYHPNKT 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,808,246 Number of Sequences: 59808 Number of extensions: 504410 Number of successful extensions: 1524 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1522 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2526446612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -