BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0268.Seq (886 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 27 1.0 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 27 1.0 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 27 1.0 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 27 1.0 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 1.3 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 26 1.3 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 5.4 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 24 7.1 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 24 7.1 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 24 7.1 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 7.1 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 26.6 bits (56), Expect = 1.0 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 76 VSDACKTTYEEIKKDKKHRYVVFYIRD 156 + AC +E+I + KH + + Y+RD Sbjct: 95 ILSACSPYFEQIFVENKHPHPIIYLRD 121 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 26.6 bits (56), Expect = 1.0 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 76 VSDACKTTYEEIKKDKKHRYVVFYIRD 156 + AC +E+I + KH + + Y+RD Sbjct: 95 ILSACSPYFEQIFVENKHPHPIIYLRD 121 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 26.6 bits (56), Expect = 1.0 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 76 VSDACKTTYEEIKKDKKHRYVVFYIRD 156 + AC +E+I + KH + + Y+RD Sbjct: 47 ILSACSPYFEQIFVENKHPHPIIYLRD 73 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 26.6 bits (56), Expect = 1.0 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 76 VSDACKTTYEEIKKDKKHRYVVFYIRD 156 + AC +E+I + KH + + Y+RD Sbjct: 95 ILSACSPYFEQIFVENKHLHPIIYLRD 121 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.2 bits (55), Expect = 1.3 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 345 DTAKVKKKMLYSSSFDALK 401 DTAKV +K+ YSS+F L+ Sbjct: 257 DTAKVFQKIFYSSAFSKLR 275 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 26.2 bits (55), Expect = 1.3 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -2 Query: 330 SGRASVSC*PPTCPGTGACIQSQTGLSAFPGTALLQILEE 211 +GR +V C PP PG AC + + T IL E Sbjct: 31 NGRQNVGCNPPGIPGGPACAGLKPMVITINSTLQTLILSE 70 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.2 bits (50), Expect = 5.4 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = +3 Query: 417 VQKYIQATDLSEASQEAVEEKLR 485 ++KY++ DLSE +E ++ +L+ Sbjct: 896 IEKYLKPLDLSEKQKEEMKSQLK 918 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 23.8 bits (49), Expect = 7.1 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +3 Query: 684 PPPAYFCREAVMRFXLKGRAAVVNYMVAHLCCRC 785 PP CR ++ LKG Y H C +C Sbjct: 38 PPNCARCRNHGLKIGLKGHKRYCKYRTCH-CEKC 70 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.8 bits (49), Expect = 7.1 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +3 Query: 684 PPPAYFCREAVMRFXLKGRAAVVNYMVAHLCCRC 785 PP CR ++ LKG Y H C +C Sbjct: 38 PPNCARCRNHGLKIGLKGHKRYCKYRTCH-CEKC 70 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 23.8 bits (49), Expect = 7.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 434 LDVLLNSDKGLFQSVERARVQH 369 +D+L +D G F VE R+ H Sbjct: 361 MDILERNDNGYFLFVEGGRIDH 382 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.8 bits (49), Expect = 7.1 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 271 SKSNRPICIPRYRPSADPR 215 S+S RP PR RP++ P+ Sbjct: 280 SRSTRPTSWPRSRPTSKPK 298 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 819,667 Number of Sequences: 2352 Number of extensions: 17082 Number of successful extensions: 86 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95093730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -