BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0262.Seq (932 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50716| Best HMM Match : WD40 (HMM E-Value=0) 161 6e-40 SB_10223| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_34371| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_57108| Best HMM Match : WD40 (HMM E-Value=7.00649e-45) 63 3e-10 SB_37154| Best HMM Match : WD40 (HMM E-Value=7.00649e-45) 63 3e-10 SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_1950| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 60 3e-09 SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 58 1e-08 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 56 3e-08 SB_46201| Best HMM Match : WD40 (HMM E-Value=0) 56 4e-08 SB_6763| Best HMM Match : WD40 (HMM E-Value=4.6e-24) 56 5e-08 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 55 7e-08 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 54 1e-07 SB_32323| Best HMM Match : WD40 (HMM E-Value=0) 54 2e-07 SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18573| Best HMM Match : WD40 (HMM E-Value=1.5e-06) 54 2e-07 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_36541| Best HMM Match : WD40 (HMM E-Value=0) 53 3e-07 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 53 3e-07 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_54574| Best HMM Match : WD40 (HMM E-Value=0) 53 3e-07 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 53 3e-07 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 53 3e-07 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25576| Best HMM Match : WD40 (HMM E-Value=1.6e-30) 53 4e-07 SB_53953| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 4e-07 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 53 4e-07 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 52 5e-07 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 52 5e-07 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 52 5e-07 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 52 5e-07 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 52 5e-07 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 52 5e-07 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 52 5e-07 SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) 52 5e-07 SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_14731| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 52 5e-07 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 52 5e-07 SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 52 5e-07 SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_57755| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 52 5e-07 SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_54475| Best HMM Match : Adeno_VII (HMM E-Value=9.4) 52 5e-07 SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_48979| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_37837| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_36825| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_35598| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_34794| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_33898| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_33514| Best HMM Match : DUF503 (HMM E-Value=1.6) 52 5e-07 SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_32886| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_29948| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_29695| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_27907| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_27247| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_26184| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_25988| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_25331| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_24868| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_22584| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_21002| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_20750| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_19937| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_19365| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 52 5e-07 SB_18964| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_18148| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 52 5e-07 SB_17776| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_16561| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 52 5e-07 SB_14675| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_14548| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_14046| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_13642| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_13143| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 52 5e-07 SB_12757| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_11792| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_11340| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_10857| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_10117| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_10054| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 52 5e-07 SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_7369| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_6429| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_5748| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_4254| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_3679| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1518| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 52 9e-07 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 52 9e-07 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 52 9e-07 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 52 9e-07 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 52 9e-07 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 52 9e-07 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 52 9e-07 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 52 9e-07 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 52 9e-07 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 52 9e-07 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 52 9e-07 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 52 9e-07 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 52 9e-07 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 52 9e-07 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 52 9e-07 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 52 9e-07 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 52 9e-07 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 52 9e-07 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 52 9e-07 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 52 9e-07 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 52 9e-07 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 52 9e-07 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 52 9e-07 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 52 9e-07 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 52 9e-07 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 52 9e-07 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 52 9e-07 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 52 9e-07 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 52 9e-07 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 52 9e-07 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 52 9e-07 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 52 9e-07 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 52 9e-07 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 52 9e-07 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 52 9e-07 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 52 9e-07 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 52 9e-07 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 >SB_50716| Best HMM Match : WD40 (HMM E-Value=0) Length = 494 Score = 161 bits (392), Expect = 6e-40 Identities = 74/84 (88%), Positives = 80/84 (95%) Frame = +2 Query: 257 VLVGHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVV 436 VLVGHRAAVNVVDFD+KYIVSASGDRTIKVW+TS+CEFVRTLNGH+ GIACLQYRDRLVV Sbjct: 308 VLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHRRGIACLQYRDRLVV 367 Query: 437 SGSSDNTIRLXDIECXSCIXVLEG 508 SGSSDNTIRL DIEC +C+ VLEG Sbjct: 368 SGSSDNTIRLWDIECGACLRVLEG 391 Score = 141 bits (342), Expect = 6e-34 Identities = 65/83 (78%), Positives = 70/83 (84%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGM 182 V+ L GHTGSVLCLQYDE I++GSSDSTVRVW+V G MLNTLIHHCEAVLHLRF GM Sbjct: 223 VKVLTGHTGSVLCLQYDENVIVTGSSDSTVRVWNVHAGDMLNTLIHHCEAVLHLRFQEGM 282 Query: 183 MVTCSKDRSIXVWDMTSTTEIML 251 MVTCSKDRSI VWDM S T+I L Sbjct: 283 MVTCSKDRSIAVWDMQSPTDISL 305 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/80 (43%), Positives = 50/80 (62%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGM 182 VR L GH + CLQY +R ++SGSSD+T+R+WD+ GA L L H E V +RF N Sbjct: 346 VRTLNGHRRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKR 405 Query: 183 MVTCSKDRSIXVWDMTSTTE 242 +V+ + D I VWD+ + + Sbjct: 406 IVSGAYDGKIKVWDLQAALD 425 Score = 65.3 bits (152), Expect = 7e-11 Identities = 28/74 (37%), Positives = 44/74 (59%) Frame = +2 Query: 281 VNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVSGSSDNTI 460 V + +D+ IVS D TIKVW+ S V+ L GH + CLQY + ++V+GSSD+T+ Sbjct: 193 VYCLQYDDHKIVSGLRDNTIKVWDKKSLACVKVLTGHTGSVLCLQYDENVIVTGSSDSTV 252 Query: 461 RLXDIECXSCIXVL 502 R+ ++ + L Sbjct: 253 RVWNVHAGDMLNTL 266 Score = 60.5 bits (140), Expect = 2e-09 Identities = 26/65 (40%), Positives = 42/65 (64%) Frame = +3 Query: 33 VLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGMMVTCSKDRSI 212 V CLQYD+ I+SG D+T++VWD + A + L H +VL L++ ++VT S D ++ Sbjct: 193 VYCLQYDDHKIVSGLRDNTIKVWDKKSLACVKVLTGHTGSVLCLQYDENVIVTGSSDSTV 252 Query: 213 XVWDM 227 VW++ Sbjct: 253 RVWNV 257 Score = 58.0 bits (134), Expect = 1e-08 Identities = 22/73 (30%), Positives = 45/73 (61%) Frame = +2 Query: 260 LVGHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVS 439 L GHR + + + ++ +VS S D TI++W+ +R L GH+ + C+++ ++ +VS Sbjct: 349 LNGHRRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVS 408 Query: 440 GSSDNTIRLXDIE 478 G+ D I++ D++ Sbjct: 409 GAYDGKIKVWDLQ 421 Score = 57.2 bits (132), Expect = 2e-08 Identities = 25/74 (33%), Positives = 44/74 (59%) Frame = +3 Query: 6 RELQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGMM 185 R L GH +V + +D++ I+S S D T++VW ST + TL H + L++ + ++ Sbjct: 307 RVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHRRGIACLQYRDRLV 366 Query: 186 VTCSKDRSIXVWDM 227 V+ S D +I +WD+ Sbjct: 367 VSGSSDNTIRLWDI 380 Score = 56.0 bits (129), Expect = 4e-08 Identities = 24/74 (32%), Positives = 45/74 (60%) Frame = +2 Query: 257 VLVGHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVV 436 VL GH +V + +DE IV+ S D T++VWN + + + TL H + L++++ ++V Sbjct: 225 VLTGHTGSVLCLQYDENVIVTGSSDSTVRVWNVHAGDMLNTLIHHCEAVLHLRFQEGMMV 284 Query: 437 SGSSDNTIRLXDIE 478 + S D +I + D++ Sbjct: 285 TCSKDRSIAVWDMQ 298 Score = 56.0 bits (129), Expect = 4e-08 Identities = 28/83 (33%), Positives = 47/83 (56%), Gaps = 9/83 (10%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDERAIISGSSDSTVRVWDVST--------GAM-LNTLIHHCEAV 155 +R L+GH V C+++D + I+SG+ D ++VWD+ G + L TL+ H V Sbjct: 386 LRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPAGTLCLRTLVEHTGRV 445 Query: 156 LHLRFCNGMMVTCSKDRSIXVWD 224 L+F + +V+ S D +I +WD Sbjct: 446 FRLQFDDFQIVSSSHDDTILIWD 468 Score = 50.8 bits (116), Expect = 2e-06 Identities = 32/116 (27%), Positives = 50/116 (43%), Gaps = 3/116 (2%) Frame = +2 Query: 170 LQRDDGHLQQGSFXXXXXXXXXXXXNAXGVLVGHRAAVNVVDFDEKYIVSASGDRTIKVW 349 LQ D+ + GS + L+ H AV + F E +V+ S DR+I VW Sbjct: 236 LQYDENVIVTGSSDSTVRVWNVHAGDMLNTLIHHCEAVLHLRFQEGMMVTCSKDRSIAVW 295 Query: 350 NTSS---CEFVRTLNGHKXGIACLQYRDRLVVSGSSDNTIRLXDIECXSCIXVLEG 508 + S R L GH+ + + + D+ +VS S D TI++ + L G Sbjct: 296 DMQSPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNG 351 Score = 44.8 bits (101), Expect = 1e-04 Identities = 30/81 (37%), Positives = 40/81 (49%), Gaps = 9/81 (11%) Frame = +2 Query: 257 VLVGHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSC---------EFVRTLNGHKXGIAC 409 VL GH V + FD K IVS + D IKVW+ + +RTL H + Sbjct: 388 VLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPAGTLCLRTLVEHTGRVFR 447 Query: 410 LQYRDRLVVSGSSDNTIRLXD 472 LQ+ D +VS S D+TI + D Sbjct: 448 LQFDDFQIVSSSHDDTILIWD 468 Score = 44.0 bits (99), Expect = 2e-04 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 3/79 (3%) Frame = +3 Query: 21 HTGSVLCLQYDERAIISGSSDSTVRVWDVSTG---AMLNTLIHHCEAVLHLRFCNGMMVT 191 H +VL L++ E +++ S D ++ VWD+ + ++ L+ H AV + F + +V+ Sbjct: 269 HCEAVLHLRFQEGMMVTCSKDRSIAVWDMQSPTDISLRRVLVGHRAAVNVVDFDDKYIVS 328 Query: 192 CSKDRSIXVWDMTSTTEIM 248 S DR+I VW TST E + Sbjct: 329 ASGDRTIKVWS-TSTCEFV 346 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/37 (48%), Positives = 25/37 (67%) Frame = +2 Query: 398 GIACLQYRDRLVVSGSSDNTIRLXDIECXSCIXVLEG 508 G+ CLQY D +VSG DNTI++ D + +C+ VL G Sbjct: 192 GVYCLQYDDHKIVSGLRDNTIKVWDKKSLACVKVLTG 228 >SB_10223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 81.8 bits (193), Expect = 7e-16 Identities = 40/113 (35%), Positives = 61/113 (53%) Frame = +2 Query: 170 LQRDDGHLQQGSFXXXXXXXXXXXXNAXGVLVGHRAAVNVVDFDEKYIVSASGDRTIKVW 349 LQ D+ + GS+ VL GH+ V+ + FDE +VS S D TI+VW Sbjct: 568 LQFDNERIISGSWDMTIMVWHIVKFTRLHVLYGHKGCVSCLRFDENTLVSGSHDSTIRVW 627 Query: 350 NTSSCEFVRTLNGHKXGIACLQYRDRLVVSGSSDNTIRLXDIECXSCIXVLEG 508 + + E V L GH+ ++CL++ V+SGS+D TI+L ++E C+ L G Sbjct: 628 DMRTWECVLVLQGHEGAVSCLEFDAPFVLSGSADKTIKLWNVESGDCLNTLRG 680 Score = 74.5 bits (175), Expect = 1e-13 Identities = 34/81 (41%), Positives = 50/81 (61%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGM 182 VR LQGH VLCLQ+D R +++GSSD T+R+WDV +G + + H V L+F N Sbjct: 515 VRRLQGHMDVVLCLQFDRRRVVTGSSDRTIRMWDVRSGRSIRKMKGHKGGVRCLQFDNER 574 Query: 183 MVTCSKDRSIXVWDMTSTTEI 245 +++ S D +I VW + T + Sbjct: 575 IISGSWDMTIMVWHIVKFTRL 595 Score = 73.7 bits (173), Expect = 2e-13 Identities = 32/81 (39%), Positives = 49/81 (60%) Frame = +2 Query: 266 GHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVSGS 445 GH+ V + FD + I+S S D TI VW+ + L GHK ++CL++ + +VSGS Sbjct: 560 GHKGGVRCLQFDNERIISGSWDMTIMVWHIVKFTRLHVLYGHKGCVSCLRFDENTLVSGS 619 Query: 446 SDNTIRLXDIECXSCIXVLEG 508 D+TIR+ D+ C+ VL+G Sbjct: 620 HDSTIRVWDMRTWECVLVLQG 640 Score = 68.9 bits (161), Expect = 5e-12 Identities = 32/83 (38%), Positives = 49/83 (59%) Frame = +2 Query: 260 LVGHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVS 439 L GH V + FD + +V+ S DRTI++W+ S +R + GHK G+ CLQ+ + ++S Sbjct: 518 LQGHMDVVLCLQFDRRRVVTGSSDRTIRMWDVRSGRSIRKMKGHKGGVRCLQFDNERIIS 577 Query: 440 GSSDNTIRLXDIECXSCIXVLEG 508 GS D TI + I + + VL G Sbjct: 578 GSWDMTIMVWHIVKFTRLHVLYG 600 Score = 68.9 bits (161), Expect = 5e-12 Identities = 33/75 (44%), Positives = 44/75 (58%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGM 182 +R+++GH G V CLQ+D IISGS D T+ VW + L+ L H V LRF Sbjct: 555 IRKMKGHKGGVRCLQFDNERIISGSWDMTIMVWHIVKFTRLHVLYGHKGCVSCLRFDENT 614 Query: 183 MVTCSKDRSIXVWDM 227 +V+ S D +I VWDM Sbjct: 615 LVSGSHDSTIRVWDM 629 Score = 64.9 bits (151), Expect = 9e-11 Identities = 31/74 (41%), Positives = 46/74 (62%) Frame = +3 Query: 12 LQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGMMVT 191 L GH G V CL++DE ++SGS DST+RVWD+ T + L H AV L F +++ Sbjct: 598 LYGHKGCVSCLRFDENTLVSGSHDSTIRVWDMRTWECVLVLQGHEGAVSCLEFDAPFVLS 657 Query: 192 CSKDRSIXVWDMTS 233 S D++I +W++ S Sbjct: 658 GSADKTIKLWNVES 671 Score = 64.9 bits (151), Expect = 9e-11 Identities = 39/125 (31%), Positives = 60/125 (48%), Gaps = 9/125 (7%) Frame = +2 Query: 170 LQRDDGHLQQGSFXXXXXXXXXXXXNAXGVLVGHRAAVNVVDFDEKYIVSASGDRTIKVW 349 L+ D+ L GS VL GH AV+ ++FD +++S S D+TIK+W Sbjct: 608 LRFDENTLVSGSHDSTIRVWDMRTWECVLVLQGHEGAVSCLEFDAPFVLSGSADKTIKLW 667 Query: 350 NTSSCEFVRTLNGH-------KXGIACLQYRDRLVVSGSSDNTIRLXDIECXSCIXVLEG 508 N S + + TL GH K + +Q L++SGS+D I D++ C ++ Sbjct: 668 NVESGDCLNTLRGHADAVTSVKVTLDTVQVIGELILSGSADGMILFWDLDSGHCEAAIQA 727 Query: 509 --GPV 517 GPV Sbjct: 728 HEGPV 732 Score = 62.5 bits (145), Expect = 5e-10 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 7/81 (8%) Frame = +3 Query: 12 LQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLR-------F 170 LQGH G+V CL++D ++SGS+D T+++W+V +G LNTL H +AV ++ Sbjct: 638 LQGHEGAVSCLEFDAPFVLSGSADKTIKLWNVESGDCLNTLRGHADAVTSVKVTLDTVQV 697 Query: 171 CNGMMVTCSKDRSIXVWDMTS 233 ++++ S D I WD+ S Sbjct: 698 IGELILSGSADGMILFWDLDS 718 Score = 45.2 bits (102), Expect = 8e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +2 Query: 371 VRTLNGHKXGIACLQYRDRLVVSGSSDNTIRLXDIECXSCIXVLEG 508 VR L GH + CLQ+ R VV+GSSD TIR+ D+ I ++G Sbjct: 515 VRRLQGHMDVVLCLQFDRRRVVTGSSDRTIRMWDVRSGRSIRKMKG 560 Score = 32.3 bits (70), Expect = 0.58 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = +3 Query: 87 TVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGMMVTCSKDRSIXVWDMTSTTEI 245 ++ V V T + L H + VL L+F +VT S DR+I +WD+ S I Sbjct: 503 SLAVQGVLTIKRVRRLQGHMDVVLCLQFDRRRVVTGSSDRTIRMWDVRSGRSI 555 >SB_34371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 644 Score = 68.5 bits (160), Expect = 7e-12 Identities = 29/77 (37%), Positives = 46/77 (59%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGM 182 + LQGHT V LQ+D I+SGS D+++RVW TG L+TL+ H + N Sbjct: 472 IHTLQGHTNRVYSLQFDGTYIVSGSLDTSIRVWHAETGQCLHTLVGHQSLTSGMELRNNT 531 Query: 183 MVTCSKDRSIXVWDMTS 233 +V+ + D ++ +WD+T+ Sbjct: 532 LVSGNADSTVKIWDITT 548 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/88 (38%), Positives = 48/88 (54%) Frame = +2 Query: 245 NAXGVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRD 424 N VLVGH AAV V +D +VS + D +KVW+ + + + TL GH + LQ+ Sbjct: 430 NCLHVLVGHLAAVRCVKYDGHRVVSGAYDFLVKVWDPETEQCIHTLQGHTNRVYSLQFDG 489 Query: 425 RLVVSGSSDNTIRLXDIECXSCIXVLEG 508 +VSGS D +IR+ E C+ L G Sbjct: 490 TYIVSGSLDTSIRVWHAETGQCLHTLVG 517 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/83 (39%), Positives = 44/83 (53%) Frame = +2 Query: 260 LVGHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVS 439 L GH V IVS S DRT+KVWN + + TL GH + C+ + +VVS Sbjct: 355 LTGHTGGVWSSQLSGHIIVSGSTDRTLKVWNAETGYCMHTLYGHTSTVRCMDMHEEVVVS 414 Query: 440 GSSDNTIRLXDIECXSCIXVLEG 508 GS D T+R+ D +C+ VL G Sbjct: 415 GSRDGTLRVWDTTTGNCLHVLVG 437 Score = 67.3 bits (157), Expect = 2e-11 Identities = 30/83 (36%), Positives = 48/83 (57%) Frame = +2 Query: 260 LVGHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVS 439 L GH + V +D E+ +VS S D T++VW+T++ + L GH + C++Y VVS Sbjct: 395 LYGHTSTVRCMDMHEEVVVSGSRDGTLRVWDTTTGNCLHVLVGHLAAVRCVKYDGHRVVS 454 Query: 440 GSSDNTIRLXDIECXSCIXVLEG 508 G+ D +++ D E CI L+G Sbjct: 455 GAYDFLVKVWDPETEQCIHTLQG 477 Score = 66.1 bits (154), Expect = 4e-11 Identities = 37/123 (30%), Positives = 61/123 (49%), Gaps = 1/123 (0%) Frame = +2 Query: 143 LRGGAAPALLQRDDGH-LQQGSFXXXXXXXXXXXXNAXGVLVGHRAAVNVVDFDEKYIVS 319 L G A + DGH + G++ L GH V + FD YIVS Sbjct: 435 LVGHLAAVRCVKYDGHRVVSGAYDFLVKVWDPETEQCIHTLQGHTNRVYSLQFDGTYIVS 494 Query: 320 ASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVSGSSDNTIRLXDIECXSCIXV 499 S D +I+VW+ + + + TL GH+ + ++ R+ +VSG++D+T+++ DI C+ Sbjct: 495 GSLDTSIRVWHAETGQCLHTLVGHQSLTSGMELRNNTLVSGNADSTVKIWDITTGQCLQT 554 Query: 500 LEG 508 L G Sbjct: 555 LAG 557 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/71 (39%), Positives = 43/71 (60%) Frame = +3 Query: 12 LQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGMMVT 191 L GHT +V C+ E ++SGS D T+RVWD +TG L+ L+ H AV +++ +V+ Sbjct: 395 LYGHTSTVRCMDMHEEVVVSGSRDGTLRVWDTTTGNCLHVLVGHLAAVRCVKYDGHRVVS 454 Query: 192 CSKDRSIXVWD 224 + D + VWD Sbjct: 455 GAYDFLVKVWD 465 Score = 62.1 bits (144), Expect = 6e-10 Identities = 29/77 (37%), Positives = 45/77 (58%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGM 182 +R L GHTG V Q I+SGS+D T++VW+ TG ++TL H V + + Sbjct: 352 LRTLTGHTGGVWSSQLSGHIIVSGSTDRTLKVWNAETGYCMHTLYGHTSTVRCMDMHEEV 411 Query: 183 MVTCSKDRSIXVWDMTS 233 +V+ S+D ++ VWD T+ Sbjct: 412 VVSGSRDGTLRVWDTTT 428 Score = 61.3 bits (142), Expect = 1e-09 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 1/85 (1%) Frame = +2 Query: 257 VLVGHRA-AVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLV 433 +L GH + + F +VS S D T+KVW+ S + +RTL GH G+ Q ++ Sbjct: 313 ILKGHDDHVITCLQFSGSRVVSGSDDGTLKVWSALSGKCLRTLTGHTGGVWSSQLSGHII 372 Query: 434 VSGSSDNTIRLXDIECXSCIXVLEG 508 VSGS+D T+++ + E C+ L G Sbjct: 373 VSGSTDRTLKVWNAETGYCMHTLYG 397 Score = 60.5 bits (140), Expect = 2e-09 Identities = 27/106 (25%), Positives = 55/106 (51%), Gaps = 3/106 (2%) Frame = +2 Query: 170 LQRDDGHLQQGSFXXXXXXXXXXXXNAXGVLVGHRAAVNVVDFDEKYIVSASGDRTIKVW 349 LQ D ++ GS LVGH++ + ++ +VS + D T+K+W Sbjct: 485 LQFDGTYIVSGSLDTSIRVWHAETGQCLHTLVGHQSLTSGMELRNNTLVSGNADSTVKIW 544 Query: 350 NTSSCEFVRTLNG---HKXGIACLQYRDRLVVSGSSDNTIRLXDIE 478 + ++ + ++TL G H+ + CLQ+ + V++ S D T+++ D++ Sbjct: 545 DITTGQCLQTLAGPNKHQSAVTCLQFSSKFVITSSDDGTVKIWDLQ 590 Score = 58.4 bits (135), Expect = 8e-09 Identities = 28/70 (40%), Positives = 40/70 (57%) Frame = +3 Query: 12 LQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGMMVT 191 L GH +V C++YD ++SG+ D V+VWD T ++TL H V L+F +V+ Sbjct: 435 LVGHLAAVRCVKYDGHRVVSGAYDFLVKVWDPETEQCIHTLQGHTNRVYSLQFDGTYIVS 494 Query: 192 CSKDRSIXVW 221 S D SI VW Sbjct: 495 GSLDTSIRVW 504 Score = 58.0 bits (134), Expect = 1e-08 Identities = 26/75 (34%), Positives = 44/75 (58%), Gaps = 3/75 (4%) Frame = +3 Query: 12 LQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLI---HHCEAVLHLRFCNGM 182 L GH ++ ++SG++DSTV++WD++TG L TL H AV L+F + Sbjct: 515 LVGHQSLTSGMELRNNTLVSGNADSTVKIWDITTGQCLQTLAGPNKHQSAVTCLQFSSKF 574 Query: 183 MVTCSKDRSIXVWDM 227 ++T S D ++ +WD+ Sbjct: 575 VITSSDDGTVKIWDL 589 Score = 55.6 bits (128), Expect = 5e-08 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 1/72 (1%) Frame = +3 Query: 12 LQGHTGSVL-CLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGMMV 188 L+GH V+ CLQ+ ++SGS D T++VW +G L TL H V + ++V Sbjct: 314 LKGHDDHVITCLQFSGSRVVSGSDDGTLKVWSALSGKCLRTLTGHTGGVWSSQLSGHIIV 373 Query: 189 TCSKDRSIXVWD 224 + S DR++ VW+ Sbjct: 374 SGSTDRTLKVWN 385 Score = 44.4 bits (100), Expect = 1e-04 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +3 Query: 21 HTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLI 137 H +V CLQ+ + +I+ S D TV++WD+ TG + L+ Sbjct: 561 HQSAVTCLQFSSKFVITSSDDGTVKIWDLQTGEFIRDLV 599 Score = 41.9 bits (94), Expect = 7e-04 Identities = 14/38 (36%), Positives = 27/38 (71%) Frame = +2 Query: 269 HRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTL 382 H++AV + F K+++++S D T+K+W+ + EF+R L Sbjct: 561 HQSAVTCLQFSSKFVITSSDDGTVKIWDLQTGEFIRDL 598 >SB_57108| Best HMM Match : WD40 (HMM E-Value=7.00649e-45) Length = 243 Score = 63.3 bits (147), Expect = 3e-10 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 3/77 (3%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDERAIISGSSDSTVRVWDVS---TGAMLNTLIHHCEAVLHLRFC 173 VR +GHT + C+Q+D+ I+SGSSD T++VWD+S T A+L TL H V L Sbjct: 19 VRTFEGHTQGISCVQFDDTRIVSGSSDKTIKVWDLSREDTSAVL-TLAGHSGTVRCLNLN 77 Query: 174 NGMMVTCSKDRSIXVWD 224 +V+ S DRSI V D Sbjct: 78 GNRLVSGSVDRSIKVDD 94 Score = 59.7 bits (138), Expect = 3e-09 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 2/71 (2%) Frame = +2 Query: 266 GHRAAVNVVDFDEKYIVSASGDRTIKVWNTS--SCEFVRTLNGHKXGIACLQYRDRLVVS 439 GH ++ V FD+ IVS S D+TIKVW+ S V TL GH + CL +VS Sbjct: 24 GHTQGISCVQFDDTRIVSGSSDKTIKVWDLSREDTSAVLTLAGHSGTVRCLNLNGNRLVS 83 Query: 440 GSSDNTIRLXD 472 GS D +I++ D Sbjct: 84 GSVDRSIKVDD 94 Score = 58.4 bits (135), Expect = 8e-09 Identities = 24/63 (38%), Positives = 41/63 (65%) Frame = +2 Query: 290 VDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVSGSSDNTIRLX 469 + D++ +VS S D+T+KVW+ + TL GH + C+Q+ + +VSGS DNTI++ Sbjct: 90 IKVDDEKVVSGSYDKTLKVWDIKTGNCKLTLRGHNAAVLCVQFDESKIVSGSYDNTIKVK 149 Query: 470 DIE 478 +I+ Sbjct: 150 EIK 152 Score = 51.6 bits (118), Expect = 9e-07 Identities = 26/58 (44%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = +2 Query: 341 KVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVSGSSDNTIRLXDI--ECXSCIXVLEG 508 K W C+ VRT GH GI+C+Q+ D +VSGSSD TI++ D+ E S + L G Sbjct: 10 KNWLNGRCD-VRTFEGHTQGISCVQFDDTRIVSGSSDKTIKVWDLSREDTSAVLTLAG 66 Score = 48.4 bits (110), Expect = 8e-06 Identities = 27/73 (36%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Frame = +3 Query: 24 TGSV-LCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGMMVTCSK 200 +GSV ++ D+ ++SGS D T++VWD+ TG TL H AVL ++F +V+ S Sbjct: 83 SGSVDRSIKVDDEKVVSGSYDKTLKVWDIKTGNCKLTLRGHNAAVLCVQFDESKIVSGSY 142 Query: 201 DRSIXVWDMTSTT 239 D +I V ++ T Sbjct: 143 DNTIKVKEIKYCT 155 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/32 (50%), Positives = 26/32 (81%) Frame = +3 Query: 12 LQGHTGSVLCLQYDERAIISGSSDSTVRVWDV 107 L+GH +VLC+Q+DE I+SGS D+T++V ++ Sbjct: 120 LRGHNAAVLCVQFDESKIVSGSYDNTIKVKEI 151 Score = 42.7 bits (96), Expect(2) = 2e-07 Identities = 27/74 (36%), Positives = 32/74 (43%) Frame = +2 Query: 143 LRGGAAPALLQRDDGHLQQGSFXXXXXXXXXXXXNAXGVLVGHRAAVNVVDFDEKYIVSA 322 L G+ ++ DD + GS+ N L GH AAV V FDE IVS Sbjct: 81 LVSGSVDRSIKVDDEKVVSGSYDKTLKVWDIKTGNCKLTLRGHNAAVLCVQFDESKIVSG 140 Query: 323 SGDRTIKVWNTSSC 364 S D TIKV C Sbjct: 141 SYDNTIKVKEIKYC 154 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +3 Query: 12 LQGHTGSVLCLQY--DERAIISGSSDSTVRVWDVSTG 116 L GH +V CL D R +ISGS D ++ WD++TG Sbjct: 206 LAGHHDAVTCLNLTLDRRKVISGSLDHNLKFWDLATG 242 Score = 31.1 bits (67), Expect(2) = 2e-07 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +2 Query: 341 KVWNTSSCEFVRTLNGHKXGIACLQYR--DRLVVSGSSDNTIRLXDI 475 +VW+ + TL GH + CL R V+SGS D+ ++ D+ Sbjct: 193 EVWSLVEGSCLMTLAGHHDAVTCLNLTLDRRKVISGSLDHNLKFWDL 239 >SB_37154| Best HMM Match : WD40 (HMM E-Value=7.00649e-45) Length = 870 Score = 63.3 bits (147), Expect = 3e-10 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 3/77 (3%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDERAIISGSSDSTVRVWDVS---TGAMLNTLIHHCEAVLHLRFC 173 VR +GHT + C+Q+D+ I+SGSSD T++VWD+S T A+L TL H V L Sbjct: 646 VRTFEGHTQGISCVQFDDTRIVSGSSDKTIKVWDLSREDTSAVL-TLAGHSGTVRCLNLN 704 Query: 174 NGMMVTCSKDRSIXVWD 224 +V+ S DRSI V D Sbjct: 705 GNRLVSGSVDRSIKVDD 721 Score = 59.7 bits (138), Expect = 3e-09 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 2/71 (2%) Frame = +2 Query: 266 GHRAAVNVVDFDEKYIVSASGDRTIKVWNTS--SCEFVRTLNGHKXGIACLQYRDRLVVS 439 GH ++ V FD+ IVS S D+TIKVW+ S V TL GH + CL +VS Sbjct: 651 GHTQGISCVQFDDTRIVSGSSDKTIKVWDLSREDTSAVLTLAGHSGTVRCLNLNGNRLVS 710 Query: 440 GSSDNTIRLXD 472 GS D +I++ D Sbjct: 711 GSVDRSIKVDD 721 Score = 58.4 bits (135), Expect = 8e-09 Identities = 24/63 (38%), Positives = 41/63 (65%) Frame = +2 Query: 290 VDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVSGSSDNTIRLX 469 + D++ +VS S D+T+KVW+ + TL GH + C+Q+ + +VSGS DNTI++ Sbjct: 717 IKVDDEKVVSGSYDKTLKVWDIKTGNCKLTLRGHNAAVLCVQFDESKIVSGSYDNTIKVK 776 Query: 470 DIE 478 +I+ Sbjct: 777 EIK 779 Score = 51.6 bits (118), Expect = 9e-07 Identities = 26/58 (44%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = +2 Query: 341 KVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVSGSSDNTIRLXDI--ECXSCIXVLEG 508 K W C+ VRT GH GI+C+Q+ D +VSGSSD TI++ D+ E S + L G Sbjct: 637 KNWLNGRCD-VRTFEGHTQGISCVQFDDTRIVSGSSDKTIKVWDLSREDTSAVLTLAG 693 Score = 48.4 bits (110), Expect = 8e-06 Identities = 27/73 (36%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Frame = +3 Query: 24 TGSV-LCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGMMVTCSK 200 +GSV ++ D+ ++SGS D T++VWD+ TG TL H AVL ++F +V+ S Sbjct: 710 SGSVDRSIKVDDEKVVSGSYDKTLKVWDIKTGNCKLTLRGHNAAVLCVQFDESKIVSGSY 769 Query: 201 DRSIXVWDMTSTT 239 D +I V ++ T Sbjct: 770 DNTIKVKEIKYCT 782 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/32 (50%), Positives = 26/32 (81%) Frame = +3 Query: 12 LQGHTGSVLCLQYDERAIISGSSDSTVRVWDV 107 L+GH +VLC+Q+DE I+SGS D+T++V ++ Sbjct: 747 LRGHNAAVLCVQFDESKIVSGSYDNTIKVKEI 778 Score = 42.7 bits (96), Expect(2) = 1e-07 Identities = 27/74 (36%), Positives = 32/74 (43%) Frame = +2 Query: 143 LRGGAAPALLQRDDGHLQQGSFXXXXXXXXXXXXNAXGVLVGHRAAVNVVDFDEKYIVSA 322 L G+ ++ DD + GS+ N L GH AAV V FDE IVS Sbjct: 708 LVSGSVDRSIKVDDEKVVSGSYDKTLKVWDIKTGNCKLTLRGHNAAVLCVQFDESKIVSG 767 Query: 323 SGDRTIKVWNTSSC 364 S D TIKV C Sbjct: 768 SYDNTIKVKEIKYC 781 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +3 Query: 12 LQGHTGSVLCLQY--DERAIISGSSDSTVRVWDVSTG 116 L GH +V CL D R +ISGS D ++ WD++TG Sbjct: 833 LAGHHDAVTCLNLTLDRRKVISGSLDHNLKFWDLATG 869 Score = 31.1 bits (67), Expect(2) = 1e-07 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +2 Query: 341 KVWNTSSCEFVRTLNGHKXGIACLQYR--DRLVVSGSSDNTIRLXDI 475 +VW+ + TL GH + CL R V+SGS D+ ++ D+ Sbjct: 820 EVWSLVEGSCLMTLAGHHDAVTCLNLTLDRRKVISGSLDHNLKFWDL 866 >SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1803 Score = 62.9 bits (146), Expect = 4e-10 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 4/76 (5%) Frame = +3 Query: 9 ELQGHTGSVL--CLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC--N 176 EL GH+ VL C D+R I SGS D T+RVWD TGA+L L H AV +R Sbjct: 1176 ELSGHSKGVLTTCFSIDDRKIFSGSEDCTIRVWDSKTGALLAQLDGHAGAVTCVRVSPDG 1235 Query: 177 GMMVTCSKDRSIXVWD 224 G++ + S D++I +W+ Sbjct: 1236 GVIASSSADKTIRLWN 1251 Score = 50.8 bits (116), Expect = 2e-06 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 4/87 (4%) Frame = +2 Query: 260 LVGHRAAVNVVDF--DEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQY--RDR 427 L GH AV V D I S+S D+TI++WN S EF+R+L GH+ + L + + Sbjct: 1219 LDGHAGAVTCVRVSPDGGVIASSSADKTIRLWNPSD-EFLRSLEGHEDRVTSLAFSKNGK 1277 Query: 428 LVVSGSSDNTIRLXDIECXSCIXVLEG 508 +VS + D +++ D+E + + L G Sbjct: 1278 RLVSVALDKKLKVWDVESGNLLDTLTG 1304 Score = 48.0 bits (109), Expect = 1e-05 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 4/79 (5%) Frame = +3 Query: 9 ELQGHTGSVLCLQY--DERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC-NG 179 +L GH G+V C++ D I S S+D T+R+W+ S L +L H + V L F NG Sbjct: 1218 QLDGHAGAVTCVRVSPDGGVIASSSADKTIRLWNPS-DEFLRSLEGHEDRVTSLAFSKNG 1276 Query: 180 -MMVTCSKDRSIXVWDMTS 233 +V+ + D+ + VWD+ S Sbjct: 1277 KRLVSVALDKKLKVWDVES 1295 Score = 44.8 bits (101), Expect = 1e-04 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 5/88 (5%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDE--RAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC- 173 +R L+GH V L + + + ++S + D ++VWDV +G +L+TL H + + Sbjct: 1257 LRSLEGHEDRVTSLAFSKNGKRLVSVALDKKLKVWDVESGNLLDTLTGHDGYPVCCAWNP 1316 Query: 174 --NGMMVTCSKDRSIXVWDMTSTTEIML 251 N M+ TC + + +WD+ + + L Sbjct: 1317 VDNTMVATCGDNLELLIWDLETKSSTRL 1344 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 4/73 (5%) Frame = +2 Query: 260 LVGHRAAVNVVDF--DEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYR--DR 427 L GH V F D++ I S S D TI+VW++ + + L+GH + C++ Sbjct: 1177 LSGHSKGVLTTCFSIDDRKIFSGSEDCTIRVWDSKTGALLAQLDGHAGAVTCVRVSPDGG 1236 Query: 428 LVVSGSSDNTIRL 466 ++ S S+D TIRL Sbjct: 1237 VIASSSADKTIRL 1249 Score = 43.6 bits (98), Expect = 2e-04 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 4/86 (4%) Frame = +3 Query: 12 LQGHTGSVLCLQY--DERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC-NGM 182 L GH+ V+ + + D + SGS D TVRVWD + L H E + + +GM Sbjct: 1454 LGGHSDWVMDVAFSSDGALLTSGSRDRTVRVWDCAAAEKLKKARFHSERCWSVAYSDDGM 1513 Query: 183 -MVTCSKDRSIXVWDMTSTTEIMLXE 257 + + S D + VW+M + +++ E Sbjct: 1514 WLASASDDFKVCVWNMATQQHVLVYE 1539 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Frame = +2 Query: 275 AAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYR--DRLVVSGSS 448 A V DE++I + S D+ +++W V + GH+ I + + D L+ S + Sbjct: 1678 ATCAVFSHDERHIATCSRDQKVRLWAVEGYAQVAAMEGHESEIRVVSFSPDDSLLASAAL 1737 Query: 449 DNTIRLXDI 475 D TIR+ D+ Sbjct: 1738 DQTIRVWDL 1746 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 2/67 (2%) Frame = +3 Query: 48 YDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC--NGMMVTCSKDRSIXVW 221 +DER I + S D VR+W V A + + H + + F + ++ + + D++I VW Sbjct: 1685 HDERHIATCSRDQKVRLWAVEGYAQVAAMEGHESEIRVVSFSPDDSLLASAALDQTIRVW 1744 Query: 222 DMTSTTE 242 D++S T+ Sbjct: 1745 DLSSYTQ 1751 Score = 37.5 bits (83), Expect = 0.015 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 5/81 (6%) Frame = +2 Query: 260 LVGHRAAVNVVDFDE--KYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYR--DR 427 L GH V + F + K +VS + D+ +KVW+ S + TL GH C + D Sbjct: 1260 LEGHEDRVTSLAFSKNGKRLVSVALDKKLKVWDVESGNLLDTLTGHDGYPVCCAWNPVDN 1319 Query: 428 LVVSGSSDN-TIRLXDIECXS 487 +V+ DN + + D+E S Sbjct: 1320 TMVATCGDNLELLIWDLETKS 1340 Score = 35.5 bits (78), Expect = 0.062 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +2 Query: 368 FVRTLNGHKXGI--ACLQYRDRLVVSGSSDNTIRLXDIECXSCIXVLEG 508 F L+GH G+ C DR + SGS D TIR+ D + + + L+G Sbjct: 1173 FQMELSGHSKGVLTTCFSIDDRKIFSGSEDCTIRVWDSKTGALLAQLDG 1221 Score = 35.5 bits (78), Expect = 0.062 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 4/87 (4%) Frame = +2 Query: 260 LVGHRAAVNVVDFDE--KYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIAC--LQYRDR 427 L GH +F ++I+S+S D T +VW + V TL H C + +R Sbjct: 1630 LGGHDMFCQYTEFSPSGEFIISSSIDNTAQVWRFDTHRHVTTLQ-HPDWATCAVFSHDER 1688 Query: 428 LVVSGSSDNTIRLXDIECXSCIXVLEG 508 + + S D +RL +E + + +EG Sbjct: 1689 HIATCSRDQKVRLWAVEGYAQVAAMEG 1715 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 2/71 (2%) Frame = +2 Query: 155 AAPALLQRDDGHLQQGSFXXXXXXXXXXXXNAXGVLVGHRAAVNVVDF--DEKYIVSASG 328 A A+ D+ H+ S + GH + + VV F D+ + SA+ Sbjct: 1678 ATCAVFSHDERHIATCSRDQKVRLWAVEGYAQVAAMEGHESEIRVVSFSPDDSLLASAAL 1737 Query: 329 DRTIKVWNTSS 361 D+TI+VW+ SS Sbjct: 1738 DQTIRVWDLSS 1748 Score = 33.5 bits (73), Expect = 0.25 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +3 Query: 63 IISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHL-RFCNGMMVTCSKDRSIXVWDMTSTT 239 IIS S D+T +VW T + TL H A + + TCS+D+ + +W + Sbjct: 1649 IISSSIDNTAQVWRFDTHRHVTTLQHPDWATCAVFSHDERHIATCSRDQKVRLWAVEGYA 1708 Query: 240 EIMLXE 257 ++ E Sbjct: 1709 QVAAME 1714 Score = 32.7 bits (71), Expect = 0.44 Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 4/88 (4%) Frame = +2 Query: 257 VLVGHRAAVNVVDF--DEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRD-- 424 +L GH V V F D + S S DRT++VW+ ++ E ++ H + Y D Sbjct: 1453 LLGGHSDWVMDVAFSSDGALLTSGSRDRTVRVWDCAAAEKLKKARFHSERCWSVAYSDDG 1512 Query: 425 RLVVSGSSDNTIRLXDIECXSCIXVLEG 508 + S S D + + ++ + V EG Sbjct: 1513 MWLASASDDFKVCVWNMATQQHVLVYEG 1540 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/39 (30%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +3 Query: 3 VRELQGHTGSVLCLQY--DERAIISGSSDSTVRVWDVST 113 V ++GH + + + D+ + S + D T+RVWD+S+ Sbjct: 1710 VAAMEGHESEIRVVSFSPDDSLLASAALDQTIRVWDLSS 1748 Score = 28.3 bits (60), Expect = 9.4 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 8/68 (11%) Frame = +2 Query: 299 DEKYIVSASGDRTIKVWNTSSCEFVRTLNGHK------XGI-ACLQYRD-RLVVSGSSDN 454 D ++ SAS D + VWN ++ + V GH+ G+ AC D LV SG + Sbjct: 1511 DGMWLASASDDFKVCVWNMATQQHVLVYEGHEKKRKFSCGVRACTFSHDASLVASGGDEL 1570 Query: 455 TIRLXDIE 478 IR+ E Sbjct: 1571 KIRVWSRE 1578 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 61.7 bits (143), Expect = 8e-10 Identities = 36/64 (56%), Positives = 38/64 (59%) Frame = -2 Query: 646 QXAKGXCAARRLSWVTPRFFRVHDVVKRRPVNXNTXXL*GEIGYRAPLEHXDARAALDVX 467 Q AKG CAARRLSWVTP F HDVVKRRPVN NT YRA AAL++ Sbjct: 40 QLAKGGCAARRLSWVTPG-FPSHDVVKRRPVNCNTTH------YRANWSSTAVAAALELV 92 Query: 466 QPDG 455 P G Sbjct: 93 DPPG 96 >SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 60.5 bits (140), Expect = 2e-09 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 4/83 (4%) Frame = +2 Query: 257 VLVGHRAAVNVVDF--DEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYR--D 424 V H A V VDF D + +++AS D+++KVW +F+ +LN H + C ++ Sbjct: 23 VFKAHTATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSPDG 82 Query: 425 RLVVSGSSDNTIRLXDIECXSCI 493 RL+VSGS D TI+L D C+ Sbjct: 83 RLIVSGSDDKTIKLWDRTSKDCV 105 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Frame = +2 Query: 299 DEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYR--DRLVVSGSSDNTIRLXD 472 D + IVS S D+TIK+W+ +S + V T + +++ + +G +D+T+++ D Sbjct: 81 DGRLIVSGSDDKTIKLWDRTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKILD 140 Query: 473 I 475 + Sbjct: 141 L 141 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = +3 Query: 12 LQGHTGSVLCLQY--DERAIISGSSDSTVRVWDVSTGAMLNT 131 L H V C ++ D R I+SGS D T+++WD ++ ++T Sbjct: 66 LNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVHT 107 >SB_1950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 420 Score = 60.1 bits (139), Expect = 3e-09 Identities = 24/74 (32%), Positives = 45/74 (60%) Frame = +2 Query: 245 NAXGVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRD 424 N+ +L R + ++FD++ +V+ GD I VW+ + E TL+GH + CL + D Sbjct: 247 NSGKLLQTLRGHTDEIEFDDEKVVTGGGDNLIMVWSAHTGECTATLSGHTGEVYCLAFND 306 Query: 425 RLVVSGSSDNTIRL 466 ++ SGS+D+++R+ Sbjct: 307 EIIASGSADSSVRI 320 Score = 46.8 bits (106), Expect = 3e-05 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 1/80 (1%) Frame = +2 Query: 257 VLVGHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLN-GHKXGIACLQYRDRLV 433 +L GHR +N + + + +VSA D +VW+ L+ H + C+Q Sbjct: 159 ILRGHREPINDIACNGRVLVSAGSDNCARVWDIKEARCTHVLDTPHTDSVRCVQLVPPKC 218 Query: 434 VSGSSDNTIRLXDIECXSCI 493 V+G +D +R+ ++ +CI Sbjct: 219 VTGCADGVVRIFNVNTGACI 238 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/35 (51%), Positives = 24/35 (68%) Frame = +3 Query: 12 LQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTG 116 L GHTG V CL +++ I SGS+DS+VR+W G Sbjct: 292 LSGHTGEVYCLAFNDEIIASGSADSSVRIWSFRDG 326 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/59 (32%), Positives = 29/59 (49%) Frame = +2 Query: 332 RTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVSGSSDNTIRLXDIECXSCIXVLEG 508 R + +WN +S + ++TL GH I ++ D VV+G DN I + C L G Sbjct: 239 RNVCIWNANSGKLLQTLRGHTDEI---EFDDEKVVTGGGDNLIMVWSAHTGECTATLSG 294 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = +2 Query: 341 KVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVSGSSDNTIRLXDIECXSCIXVLE 505 K W T + L GH+ I + R++VS SDN R+ DI+ C VL+ Sbjct: 147 KNWETGNYTIAPILRGHREPINDIACNGRVLVSAGSDNCARVWDIKEARCTHVLD 201 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 21 HTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTL 134 HT SV C+Q ++G +D VR+++V+TGA + + Sbjct: 204 HTDSVRCVQLVPPKCVTGCADGVVRIFNVNTGACIRNV 241 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/97 (22%), Positives = 44/97 (45%), Gaps = 1/97 (1%) Frame = +3 Query: 12 LQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTL-IHHCEAVLHLRFCNGMMV 188 L+GH + + + R ++S SD+ RVWD+ + L H ++V ++ V Sbjct: 160 LRGHREPINDIACNGRVLVSAGSDNCARVWDIKEARCTHVLDTPHTDSVRCVQLVPPKCV 219 Query: 189 TCSKDRSIXVWDMTSTTEIMLXECWWDTGPLSMSLTL 299 T D + ++++ +T + C W+ + TL Sbjct: 220 TGCADGVVRIFNV-NTGACIRNVCIWNANSGKLLQTL 255 Score = 28.7 bits (61), Expect = 7.1 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 260 LVGHRAAVNVVDFDEKYIVSASGDRTIKVWN 352 L GH V + F+++ I S S D ++++W+ Sbjct: 292 LSGHTGEVYCLAFNDEIIASGSADSSVRIWS 322 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 60.1 bits (139), Expect = 3e-09 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -1 Query: 680 GRIV-AGXFAIKPXGERGMCCKAIKLGNAQVFPSSRRCKTTAS 555 GR + AG FAI P GERGMCCKAIKLGNA+VFP + KTTAS Sbjct: 21 GRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVT-TFKTTAS 62 >SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1649 Score = 58.4 bits (135), Expect = 8e-09 Identities = 33/88 (37%), Positives = 53/88 (60%), Gaps = 5/88 (5%) Frame = +2 Query: 260 LVGHRAAVN--VVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHK---XGIACLQYRD 424 L GH+ V+ +V D K I+S+S D+T+K+W+ +C FV +L+GH GIA + Sbjct: 786 LKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIA-ITSDG 844 Query: 425 RLVVSGSSDNTIRLXDIECXSCIXVLEG 508 R +VS S D T+R+ ++E + + L G Sbjct: 845 RRLVSASQDRTLRIWNLETFAHVSTLRG 872 Score = 55.6 bits (128), Expect = 5e-08 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 2/91 (2%) Frame = +2 Query: 266 GHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGI--ACLQYRDRLVVS 439 GH + + D + +VSAS DRT+++WN + V TL GH + C D+ +S Sbjct: 833 GHVRGIAITS-DGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAIS 891 Query: 440 GSSDNTIRLXDIECXSCIXVLEGGPVPNFAL 532 GS D +++ D+E + L G FA+ Sbjct: 892 GSEDTMVKIWDLESAKEVRSLVGHTSDIFAV 922 Score = 51.6 bits (118), Expect = 9e-07 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 5/86 (5%) Frame = +3 Query: 3 VRELQGHTGSV--LCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC- 173 V L GH G V + + D R ++S S D T+R+W++ T A ++TL H E V + C Sbjct: 825 VNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETV-YCVCCS 883 Query: 174 --NGMMVTCSKDRSIXVWDMTSTTEI 245 + ++ S+D + +WD+ S E+ Sbjct: 884 PDDKFAISGSEDTMVKIWDLESAKEV 909 Score = 49.6 bits (113), Expect = 4e-06 Identities = 25/79 (31%), Positives = 44/79 (55%), Gaps = 4/79 (5%) Frame = +3 Query: 3 VRELQGHTGSVLCLQY--DERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC- 173 +R + G + ++L + D + II+G +D ++RVWD TG LN L+ H + V L Sbjct: 699 LRTIDGRSRTILGIAVTPDTKKIITGGADGSIRVWDYETGKELNKLLDHTKLVYTLALSP 758 Query: 174 -NGMMVTCSKDRSIXVWDM 227 +V+ + D ++ +WDM Sbjct: 759 HADFLVSGAFDHTVKIWDM 777 Score = 48.8 bits (111), Expect = 6e-06 Identities = 27/85 (31%), Positives = 47/85 (55%), Gaps = 4/85 (4%) Frame = +3 Query: 3 VRELQGHTGSV--LCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCN 176 V L+GH V + + D + IIS S D TV++WDV T A +N+L H V + + Sbjct: 783 VHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAITS 842 Query: 177 G--MMVTCSKDRSIXVWDMTSTTEI 245 +V+ S+DR++ +W++ + + Sbjct: 843 DGRRLVSASQDRTLRIWNLETFAHV 867 Score = 48.4 bits (110), Expect = 8e-06 Identities = 20/69 (28%), Positives = 40/69 (57%), Gaps = 2/69 (2%) Frame = +2 Query: 308 YIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIA--CLQYRDRLVVSGSSDNTIRLXDIEC 481 ++VS + D T+K+W+ + V TL GHK ++ + + ++S S D T+++ D+E Sbjct: 762 FLVSGAFDHTVKIWDMDTLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVET 821 Query: 482 XSCIXVLEG 508 + + L+G Sbjct: 822 CAFVNSLDG 830 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/85 (25%), Positives = 44/85 (51%), Gaps = 4/85 (4%) Frame = +3 Query: 3 VRELQGHTGSVLCL--QYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC- 173 V L+GH+ +V C+ D++ ISGS D+ V++WD+ + + +L+ H + + Sbjct: 867 VSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSLVGHTSDIFAVAVTP 926 Query: 174 -NGMMVTCSKDRSIXVWDMTSTTEI 245 +++ D + VW + S E+ Sbjct: 927 DGSKVISSGDDTQVKVWSLESGEEL 951 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 4/85 (4%) Frame = +3 Query: 3 VRELQGHTGSVLCLQY--DERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC- 173 VR L GHT + + D +IS D+ V+VW + +G L +L H E+V + Sbjct: 909 VRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSESVRIVTVSP 968 Query: 174 NGM-MVTCSKDRSIXVWDMTSTTEI 245 +G+ +V+ S+D + +W + S I Sbjct: 969 DGLTIVSGSEDATFKIWRIASMNTI 993 Score = 41.1 bits (92), Expect = 0.001 Identities = 29/88 (32%), Positives = 43/88 (48%), Gaps = 5/88 (5%) Frame = +2 Query: 260 LVGHRAAVNVVDF--DEKYIVSASGDRTIKVWNTSSCEFVRTLNGHK---XGIACLQYRD 424 L GH +V +V D IVS S D T K+W +S + + GHK GIA + D Sbjct: 954 LHGHSESVRIVTVSPDGLTIVSGSEDATFKIWRIASMNTISPVLGHKRTINGIALSKNGD 1013 Query: 425 RLVVSGSSDNTIRLXDIECXSCIXVLEG 508 V+GS D+ +++ D + S + G Sbjct: 1014 -FCVTGSDDSLVKVWDGKIYSELMTFSG 1040 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 4/83 (4%) Frame = +3 Query: 12 LQGHTGSV--LCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC-NG- 179 L GH+ SV + + D I+SGS D+T ++W +++ ++ ++ H + + NG Sbjct: 954 LHGHSESVRIVTVSPDGLTIVSGSEDATFKIWRIASMNTISPVLGHKRTINGIALSKNGD 1013 Query: 180 MMVTCSKDRSIXVWDMTSTTEIM 248 VT S D + VWD +E+M Sbjct: 1014 FCVTGSDDSLVKVWDGKIYSELM 1036 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 4/87 (4%) Frame = +2 Query: 260 LVGHRAAVNVVDF--DEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYR-DRL 430 LVGH + + V D ++S+ D +KVW+ S E + +L+GH + + D L Sbjct: 912 LVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSESVRIVTVSPDGL 971 Query: 431 -VVSGSSDNTIRLXDIECXSCIXVLEG 508 +VSGS D T ++ I + I + G Sbjct: 972 TIVSGSEDATFKIWRIASMNTISPVLG 998 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/79 (27%), Positives = 44/79 (55%), Gaps = 4/79 (5%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDERA--IISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC- 173 + +L HT V L A ++SG+ D TV++WD+ T ++++TL H V + Sbjct: 741 LNKLLDHTKLVYTLALSPHADFLVSGAFDHTVKIWDMDTLSLVHTLKGHKNWVSGVLVTP 800 Query: 174 -NGMMVTCSKDRSIXVWDM 227 + +++ S D+++ +WD+ Sbjct: 801 DSKRIISSSYDKTVKIWDV 819 Score = 33.5 bits (73), Expect = 0.25 Identities = 18/77 (23%), Positives = 37/77 (48%), Gaps = 3/77 (3%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDERA--IISGSSDSTVRVWDVSTGAMLNTLIHHCE-AVLHLRFC 173 +R GH G + + + ++S T++ WD+ +G + + H E L + C Sbjct: 1530 IRSANGHWGRYNVVSFFPQGDQVVSNGHHFTLKQWDLGSGRIKHIYPHSNEITTLCVLPC 1589 Query: 174 NGMMVTCSKDRSIXVWD 224 +VT S+D+ + +W+ Sbjct: 1590 GRYLVTGSRDKILRLWE 1606 Score = 32.7 bits (71), Expect = 0.44 Identities = 18/81 (22%), Positives = 36/81 (44%), Gaps = 4/81 (4%) Frame = +2 Query: 245 NAXGVLVGHRAAVNVVDFDEK--YIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQY 418 N ++GH+ +N + + + V+ S D +KVW+ + T +GH + + Sbjct: 991 NTISPVLGHKRTINGIALSKNGDFCVTGSDDSLVKVWDGKIYSELMTFSGHTDCVQAIAL 1050 Query: 419 --RDRLVVSGSSDNTIRLXDI 475 L SG +D I + ++ Sbjct: 1051 CPDSSLAASGGNDCVINIWNL 1071 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 58.0 bits (134), Expect = 1e-08 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = -1 Query: 680 GRIV-AGXFAIKPXGERGMCCKAIKLGNAQVFPS 582 GR + AG FAI P GERGMCCKAIKLGNA VFPS Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLGNASVFPS 47 Score = 36.3 bits (80), Expect = 0.035 Identities = 27/79 (34%), Positives = 32/79 (40%) Frame = -2 Query: 691 LLGRGEXXXXXXXXSQXAKGXCAARRLSWVTPRFFRVHDVVKRRPVNXNTXXL*GEIGYR 512 LLGR +G C + + F HDVVKRRPVN NT YR Sbjct: 12 LLGRAIGAGLFAITPAGERGMCC-KAIKLGNASVFPSHDVVKRRPVNCNTTH------YR 64 Query: 511 APLEHXDARAALDVXQPDG 455 A AAL++ P G Sbjct: 65 ANWSSTAVAAALELVDPPG 83 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -1 Query: 674 IVAGXFAIKPXGERGMCCKAIKLGNAQVFPS 582 I AG FAI P GERGMCCKAIKLGNA VFPS Sbjct: 3 IGAGLFAITPAGERGMCCKAIKLGNASVFPS 33 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 589 FRVHDVVKRRPVNXNT 542 F HDVVKRRPVN NT Sbjct: 31 FPSHDVVKRRPVNCNT 46 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 56.4 bits (130), Expect = 3e-08 Identities = 29/83 (34%), Positives = 47/83 (56%), Gaps = 3/83 (3%) Frame = +2 Query: 269 HRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDR---LVVS 439 H V+V+ E +V+ S DRT+KV+ T C + TL+GH+ GI L+ +V+S Sbjct: 3165 HHQPVSVLVASEGRVVTGSHDRTLKVFRTDHCVRIFTLHGHRDGITELKVDSNNPDIVIS 3224 Query: 440 GSSDNTIRLXDIECXSCIXVLEG 508 G+S+ +R+ D+ C+ L G Sbjct: 3225 GASNGGVRVWDLSTGECLQHLRG 3247 Score = 48.8 bits (111), Expect = 6e-06 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 3/77 (3%) Frame = +3 Query: 12 LQGHTGSVLCLQYDER---AIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGM 182 L GH + L+ D +ISG+S+ VRVWD+STG L L H A+ + + Sbjct: 3202 LHGHRDGITELKVDSNNPDIVISGASNGGVRVWDLSTGECLQHLRGHTCAITTVASTHAH 3261 Query: 183 MVTCSKDRSIXVWDMTS 233 +++ S D S+ VW+ ++ Sbjct: 3262 LISVSIDNSMCVWERST 3278 Score = 35.5 bits (78), Expect = 0.062 Identities = 19/81 (23%), Positives = 39/81 (48%), Gaps = 3/81 (3%) Frame = +2 Query: 260 LVGHRAAVNVVDFDEK---YIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRL 430 L GHR + + D ++S + + ++VW+ S+ E ++ L GH I + Sbjct: 3202 LHGHRDGITELKVDSNNPDIVISGASNGGVRVWDLSTGECLQHLRGHTCAITTVASTHAH 3261 Query: 431 VVSGSSDNTIRLXDIECXSCI 493 ++S S DN++ + + C+ Sbjct: 3262 LISVSIDNSMCVWERSTGKCL 3282 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLN 128 ++ L+GHT ++ + +IS S D+++ VW+ STG L+ Sbjct: 3242 LQHLRGHTCAITTVASTHAHLISVSIDNSMCVWERSTGKCLH 3283 >SB_46201| Best HMM Match : WD40 (HMM E-Value=0) Length = 292 Score = 56.0 bits (129), Expect = 4e-08 Identities = 26/71 (36%), Positives = 42/71 (59%), Gaps = 2/71 (2%) Frame = +3 Query: 15 QGHTGSVLCLQYDE--RAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGMMV 188 +GH G++LCL D R + +GSSDST+R WD+ T + L + H +V+ ++ N +M Sbjct: 194 KGHEGAILCLAVDGKGRLLFTGSSDSTIRSWDLHTYSPLKSFKGHSASVICIQVVNKLMY 253 Query: 189 TCSKDRSIXVW 221 + S D + W Sbjct: 254 SSSADHTAKCW 264 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/115 (23%), Positives = 47/115 (40%), Gaps = 2/115 (1%) Frame = +2 Query: 170 LQRDDGHLQQGSFXXXXXXXXXXXXNAXGVLVGHRAAVNVVDFDEK--YIVSASGDRTIK 343 L +D L GS GH A+ + D K + + S D TI+ Sbjct: 163 LDNNDDILVTGSADNTAKAWGMNSNECMNTFKGHEGAILCLAVDGKGRLLFTGSSDSTIR 222 Query: 344 VWNTSSCEFVRTLNGHKXGIACLQYRDRLVVSGSSDNTIRLXDIECXSCIXVLEG 508 W+ + +++ GH + C+Q ++L+ S S+D+T + +E C G Sbjct: 223 SWDLHTYSPLKSFKGHSASVICIQVVNKLMYSSSADHTAKCWVVEFGDCTRTYRG 277 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 2/77 (2%) Frame = +3 Query: 3 VRELQGHTGSV--LCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCN 176 ++ L+ H G + +C+ D + I++GS D T R+WD T + L H + + + Sbjct: 25 IKSLEHHEGGINAMCISSDGKTIVTGSEDKTGRLWDTRTEDTIGELQGHVGYINGVCASD 84 Query: 177 GMMVTCSKDRSIXVWDM 227 TC+ D++I W + Sbjct: 85 KYAFTCASDKTIRKWSL 101 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 2/82 (2%) Frame = +2 Query: 269 HRAAVNV--VDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVSG 442 H +N + D K IV+ S D+T ++W+T + + + L GH I + D+ + Sbjct: 31 HEGGINAMCISSDGKTIVTGSEDKTGRLWDTRTEDTIGELQGHVGYINGVCASDKYAFTC 90 Query: 443 SSDNTIRLXDIECXSCIXVLEG 508 +SD TIR +E CI V +G Sbjct: 91 ASDKTIRKWSLETGRCIKVFKG 112 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 2/69 (2%) Frame = +3 Query: 27 GSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRF--CNGMMVTCSK 200 G+ + L ++ +++GS+D+T + W +++ +NT H A+L L ++ T S Sbjct: 158 GTYIDLDNNDDILVTGSADNTAKAWGMNSNECMNTFKGHEGAILCLAVDGKGRLLFTGSS 217 Query: 201 DRSIXVWDM 227 D +I WD+ Sbjct: 218 DSTIRSWDL 226 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = +2 Query: 266 GHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRL 430 GH A+V + K + S+S D T K W + RT GHK I + +D L Sbjct: 237 GHSASVICIQVVNKLMYSSSADHTAKCWVVEFGDCTRTYRGHKHCIGAMVVQDGL 291 Score = 37.1 bits (82), Expect = 0.020 Identities = 21/94 (22%), Positives = 37/94 (39%) Frame = +2 Query: 149 GGAAPALLQRDDGHLQQGSFXXXXXXXXXXXXNAXGVLVGHRAAVNVVDFDEKYIVSASG 328 GG + D + GS + G L GH +N V +KY + + Sbjct: 33 GGINAMCISSDGKTIVTGSEDKTGRLWDTRTEDTIGELQGHVGYINGVCASDKYAFTCAS 92 Query: 329 DRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRL 430 D+TI+ W+ + ++ GH + + Y +L Sbjct: 93 DKTIRKWSLETGRCIKVFKGHASTVHRVLYTAKL 126 Score = 36.7 bits (81), Expect = 0.027 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHH 143 ++ +GH+ SV+C+Q + + S S+D T + W V G T H Sbjct: 232 LKSFKGHSASVICIQVVNKLMYSSSADHTAKCWVVEFGDCTRTYRGH 278 Score = 35.1 bits (77), Expect = 0.082 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +3 Query: 3 VRELQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAV 155 + ELQGH G + + ++ + +SD T+R W + TG + H V Sbjct: 67 IGELQGHVGYINGVCASDKYAFTCASDKTIRKWSLETGRCIKVFKGHASTV 117 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 15/73 (20%) Frame = +2 Query: 335 TIKVWNTSSCEFVRTLNGHKXGIACLQY---------------RDRLVVSGSSDNTIRLX 469 T K+W + E VRT GHK G+ L + D ++V+GS+DNT + Sbjct: 123 TAKLWQADTGECVRTFKGHKRGVYPLIFVPSEINRGTYIDLDNNDDILVTGSADNTAKAW 182 Query: 470 DIECXSCIXVLEG 508 + C+ +G Sbjct: 183 GMNSNECMNTFKG 195 >SB_6763| Best HMM Match : WD40 (HMM E-Value=4.6e-24) Length = 208 Score = 55.6 bits (128), Expect = 5e-08 Identities = 28/87 (32%), Positives = 53/87 (60%), Gaps = 4/87 (4%) Frame = +2 Query: 260 LVGHRAAVNVVDF--DEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRD--R 427 + GH+A +N V F D + I SA+ D+++K+WN + +F+ +L GH + + + R Sbjct: 55 MTGHQALINQVCFSPDGRLIASAAFDKSVKLWNGETGKFITSLRGHVNCVYQIAWSADCR 114 Query: 428 LVVSGSSDNTIRLXDIECXSCIXVLEG 508 L+ SGS+D+T+++ D++ + L G Sbjct: 115 LICSGSADSTLKVWDMKTKKLLYDLPG 141 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 4/76 (5%) Frame = +3 Query: 12 LQGHTGSV--LCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGMM 185 + GH + +C D R I S + D +V++W+ TG + +L H V + + Sbjct: 55 MTGHQALINQVCFSPDGRLIASAAFDKSVKLWNGETGKFITSLRGHVNCVYQIAWSADCR 114 Query: 186 VTC--SKDRSIXVWDM 227 + C S D ++ VWDM Sbjct: 115 LICSGSADSTLKVWDM 130 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Frame = +3 Query: 3 VRELQGHTGSVLCLQY--DERAIISGSSDSTVRVWDVSTGAMLNTLIHHCE 149 + L+GH V + + D R I SGS+DST++VWD+ T +L L H + Sbjct: 94 ITSLRGHVNCVYQIAWSADCRLICSGSADSTLKVWDMKTKKLLYDLPGHAD 144 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 55.2 bits (127), Expect = 7e-08 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 689 VGKGRIVAGXFAIKPXGERGMCCKAIKLGNAQVFPS 582 VGKG G FAI P GERGMCCKAIKLGNA+ FPS Sbjct: 5 VGKGDR-CGLFAITPAGERGMCCKAIKLGNAKGFPS 39 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 55.2 bits (127), Expect = 7e-08 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 674 IVAGXFAIKPXGERGMCCKAIKLGNAQVFPS 582 I AG FAI P GERGMCCKAIKLGNA+ FPS Sbjct: 48 IGAGLFAITPAGERGMCCKAIKLGNARGFPS 78 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/55 (32%), Positives = 23/55 (41%) Frame = -2 Query: 706 FKXXNLLGRGEXXXXXXXXSQXAKGXCAARRLSWVTPRFFRVHDVVKRRPVNXNT 542 ++ LLGR +G C + + R F HD KRRPVN NT Sbjct: 38 YRVAQLLGRSIGAGLFAITPAGERGMCC-KAIKLGNARGFPSHDGEKRRPVNCNT 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 54.4 bits (125), Expect = 1e-07 Identities = 37/79 (46%), Positives = 41/79 (51%), Gaps = 4/79 (5%) Frame = -2 Query: 646 QXAKGXCAARRLSWVTPRFFRVHDVVKRRPVNXNTXXL*GEIGYRAPLEHXDARAALDVX 467 Q AKG CAARRLSW P HDVVKRRPVN NT YRA AAL++ Sbjct: 54 QLAKGGCAARRLSWGFPS----HDVVKRRPVNCNTTH------YRANWSSTAVAAALELV 103 Query: 466 QPDG----VVRGPRHDEPV 422 P G + GP EP+ Sbjct: 104 DPPGCRNSITGGPVSMEPL 122 >SB_32323| Best HMM Match : WD40 (HMM E-Value=0) Length = 611 Score = 54.0 bits (124), Expect = 2e-07 Identities = 28/76 (36%), Positives = 43/76 (56%), Gaps = 4/76 (5%) Frame = +2 Query: 260 LVGHRAAVNVVDFDEKY--IVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYR--DR 427 L+GH + F +Y I+S+S D+TI++WN S + L GH + C Q+ + Sbjct: 89 LLGHLDYIRTTFFHHEYPWILSSSDDQTIRIWNWQSRTCICVLTGHNHYVMCAQFHPSED 148 Query: 428 LVVSGSSDNTIRLXDI 475 +VVS S D T+R+ DI Sbjct: 149 MVVSASLDQTVRVWDI 164 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 4/84 (4%) Frame = +2 Query: 269 HRAAVNVVDFD--EKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRL--VV 436 H V ++F + VS D IKVWN + TL GH I + ++ Sbjct: 50 HDGPVRGINFHTVQPLFVSGGDDYKIKVWNYKQKRCLFTLLGHLDYIRTTFFHHEYPWIL 109 Query: 437 SGSSDNTIRLXDIECXSCIXVLEG 508 S S D TIR+ + + +CI VL G Sbjct: 110 SSSDDQTIRIWNWQSRTCICVLTG 133 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = +3 Query: 63 IISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRF--CNGMMVTCSKDRSIXVWDMT 230 I+S S D T+R+W+ + + L H V+ +F M+V+ S D+++ VWD++ Sbjct: 108 ILSSSDDQTIRIWNWQSRTCICVLTGHNHYVMCAQFHPSEDMVVSASLDQTVRVWDIS 165 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +3 Query: 12 LQGHTGSVLCLQY--DERAIISGSSDSTVRVWDVS 110 L GH V+C Q+ E ++S S D TVRVWD+S Sbjct: 131 LTGHNHYVMCAQFHPSEDMVVSASLDQTVRVWDIS 165 Score = 36.7 bits (81), Expect = 0.027 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 257 VLVGHRAAVNVVDFDEKY--IVSASGDRTIKVW--NTSSCEFVRTLNGHKXGIACLQYRD 424 VL GH VN V F IVS + DR +K+W N S V T GH ++C + Sbjct: 202 VLEGHDRGVNWVAFHPTMPLIVSGADDRQVKLWRMNDSKAWEVDTCRGHYNNVSCALFHP 261 Query: 425 R 427 R Sbjct: 262 R 262 Score = 31.9 bits (69), Expect = 0.76 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 4/77 (5%) Frame = +3 Query: 21 HTGSVLCLQYD--ERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCN--GMMV 188 H G V + + + +SG D ++VW+ L TL+ H + + F + ++ Sbjct: 50 HDGPVRGINFHTVQPLFVSGGDDYKIKVWNYKQKRCLFTLLGHLDYIRTTFFHHEYPWIL 109 Query: 189 TCSKDRSIXVWDMTSTT 239 + S D++I +W+ S T Sbjct: 110 SSSDDQTIRIWNWQSRT 126 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +2 Query: 257 VLVGHRAAVNVVDF--DEKYIVSASGDRTIKVWNTS 358 VL GH V F E +VSAS D+T++VW+ S Sbjct: 130 VLTGHNHYVMCAQFHPSEDMVVSASLDQTVRVWDIS 165 >SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 54.0 bits (124), Expect = 2e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 KN GVTQLNRLAAH PFA W NSE AR D P Sbjct: 18 KNTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 54.0 bits (124), Expect = 2e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 KN GVTQLNRLAAH PFA W NSE AR D P Sbjct: 18 KNTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +2 Query: 542 RIXIHWPSFYNVVNSEKPG 598 RI IHWPSFYNVV + G Sbjct: 3 RITIHWPSFYNVVTGKNTG 21 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 54.0 bits (124), Expect = 2e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 KN GVTQLNRLAAH PFA W NSE AR D P Sbjct: 18 KNTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +2 Query: 542 RIXIHWPSFYNVVNSEKPG 598 RI IHWPSFYNVV + G Sbjct: 3 RITIHWPSFYNVVTGKNTG 21 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 K LGVTQLNRLAAH PFA W NSE AR D P Sbjct: 16 KTLGVTQLNRLAAHPPFASWRNSEEARTDRP 46 Score = 28.3 bits (60), Expect = 9.4 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 554 HWPSFYNVVNSEKPG 598 HWPSFYNVV + G Sbjct: 5 HWPSFYNVVTGKTLG 19 >SB_18573| Best HMM Match : WD40 (HMM E-Value=1.5e-06) Length = 76 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/69 (34%), Positives = 35/69 (50%) Frame = +2 Query: 302 EKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVSGSSDNTIRLXDIEC 481 + Y++S S D +I++W+T+S TL GH C Q+ D VV+G DN I + Sbjct: 3 KSYVISTSWDESIRLWDTTSGTCSLTLRGHSEVAYCCQFDDEKVVTGGGDNLIMVWSAHT 62 Query: 482 XSCIXVLEG 508 C L G Sbjct: 63 GECTATLSG 71 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 12 LQGHTGSVLCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHH 143 L+GH+ C Q+D+ +++G D+ + VW TG TL H Sbjct: 29 LRGHSEVAYCCQFDDEKVVTGGGDNLIMVWSAHTGECTATLSGH 72 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = +3 Query: 63 IISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGMMVTCSKDRSIXVW 221 +IS S D ++R+WD ++G TL H E +F + +VT D I VW Sbjct: 6 VISTSWDESIRLWDTTSGTCSLTLRGHSEVAYCCQFDDEKVVTGGGDNLIMVW 58 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +2 Query: 260 LVGHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGH 391 L GH FD++ +V+ GD I VW+ + E TL+GH Sbjct: 29 LRGHSEVAYCCQFDDEKVVTGGGDNLIMVWSAHTGECTATLSGH 72 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSPLPNKXXXLKWRNGQXXXRLIFXLKFRVKF 767 +N GVTQLNRLAAH PFA W NSE AR D P L+ NG+ F L + Sbjct: 38 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP----SQQLRSLNGEWRLMRYFLLTHLCET 93 Query: 768 LVK 776 LVK Sbjct: 94 LVK 96 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSPLPNKXXXLKWRNGQXXXRLIFXLKFRVKF 767 +N GVTQLNRLAAH PFA W NSE AR D P L+ NG+ F L + Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP----SQQLRSLNGEWRLMRYFLLTHLCET 122 Query: 768 LVK 776 LVK Sbjct: 123 LVK 125 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSPLPNKXXXLKWRNGQXXXRLIFXLKFRVKF 767 +N GVTQLNRLAAH PFA W NSE AR D P L+ NG+ F L + Sbjct: 42 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP----SQQLRSLNGEWRLMRYFLLTHLCET 97 Query: 768 LVK 776 LVK Sbjct: 98 LVK 100 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSPLPNKXXXLKWRNGQXXXRLIFXLKFRVKF 767 +N GVTQLNRLAAH PFA W NSE AR D P L+ NG+ F L + Sbjct: 34 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP----SQQLRSLNGEWRLMRYFLLTHLCET 89 Query: 768 LVK 776 LVK Sbjct: 90 LVK 92 >SB_36541| Best HMM Match : WD40 (HMM E-Value=0) Length = 1070 Score = 53.2 bits (122), Expect = 3e-07 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 3/79 (3%) Frame = +2 Query: 266 GHRAAVNVVDFDEK-YIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRD--RLVV 436 GH A+N + K +++S S D T++ W+ + E GH + CLQ + + +V Sbjct: 336 GHEGAINAILVTAKDWVISGSDDSTVRAWDLENGESCAVFQGHSKPVLCLQIINDGQAIV 395 Query: 437 SGSSDNTIRLXDIECXSCI 493 SGS D +R+ D+ C+ Sbjct: 396 SGSEDKVLRVWDLVSRDCV 414 Score = 52.4 bits (120), Expect = 5e-07 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 3/78 (3%) Frame = +3 Query: 9 ELQGHTGSVLCLQYDERA-IISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNG-- 179 E +GH G++ + + +ISGS DSTVR WD+ G H + VL L+ N Sbjct: 333 EFRGHEGAINAILVTAKDWVISGSDDSTVRAWDLENGESCAVFQGHSKPVLCLQIINDGQ 392 Query: 180 MMVTCSKDRSIXVWDMTS 233 +V+ S+D+ + VWD+ S Sbjct: 393 AIVSGSEDKVLRVWDLVS 410 Score = 52.0 bits (119), Expect = 7e-07 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 4/87 (4%) Frame = +2 Query: 257 VLVGHRAAVN--VVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQY--RD 424 VL GH V ++ D +++VS S D TI++W+ + E + + GH + CL D Sbjct: 669 VLRGHDKGVTALLIMNDCRHLVSGSKDSTIRLWDLTKGECKQVMQGHTNEVLCLSVTSND 728 Query: 425 RLVVSGSSDNTIRLXDIECXSCIXVLE 505 + +VSGS+D T R+ ++ C+ ++ Sbjct: 729 KTIVSGSNDFTARVWNVATGKCVSTVK 755 Score = 49.2 bits (112), Expect = 5e-06 Identities = 21/43 (48%), Positives = 32/43 (74%), Gaps = 2/43 (4%) Frame = +3 Query: 12 LQGHTGSVLCLQY--DERAIISGSSDSTVRVWDVSTGAMLNTL 134 +QGHT VLCL +++ I+SGS+D T RVW+V+TG ++T+ Sbjct: 712 MQGHTNEVLCLSVTSNDKTIVSGSNDFTARVWNVATGKCVSTV 754 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/111 (28%), Positives = 48/111 (43%), Gaps = 5/111 (4%) Frame = +2 Query: 149 GGAAPALLQRDDG-HLQQGSFXXXXXXXXXXXXNAXGVLVGHRAAV--NVVDFDEKYIVS 319 GG L DG + G+ L GH + + V D+ IVS Sbjct: 420 GGLIKCLAAMHDGKRIVSGAKDNNIKVWDLVRLECQATLKGHTSLIWAIAVSRDDSVIVS 479 Query: 320 ASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYR--DRLVVSGSSDNTIRL 466 AS D +KVW T S +TL GH I+C+ + ++SGS+D +++ Sbjct: 480 ASKDDLLKVWRTESWVCTQTLIGHSSWISCVAMTTDGKTIISGSNDKNVKM 530 Score = 46.8 bits (106), Expect = 3e-05 Identities = 36/123 (29%), Positives = 55/123 (44%), Gaps = 4/123 (3%) Frame = +2 Query: 152 GAAPALLQRDDGHLQQGSFXXXXXXXXXXXXNAXGVLVGHRAAVNVVDF--DEKYIVSAS 325 GA A+L + GS + V GH V + D + IVS S Sbjct: 339 GAINAILVTAKDWVISGSDDSTVRAWDLENGESCAVFQGHSKPVLCLQIINDGQAIVSGS 398 Query: 326 GDRTIKVWNTSSCEFVRTLNGHKXGIACL--QYRDRLVVSGSSDNTIRLXDIECXSCIXV 499 D+ ++VW+ S + V +L GH I CL + + +VSG+ DN I++ D+ C Sbjct: 399 EDKVLRVWDLVSRDCV-SLKGHGGLIKCLAAMHDGKRIVSGAKDNNIKVWDLVRLECQAT 457 Query: 500 LEG 508 L+G Sbjct: 458 LKG 460 Score = 44.8 bits (101), Expect = 1e-04 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 4/78 (5%) Frame = +3 Query: 12 LQGHTGSV--LCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNG-- 179 L+GH V L + D R ++SGS DST+R+WD++ G + H VL L + Sbjct: 670 LRGHDKGVTALLIMNDCRHLVSGSKDSTIRLWDLTKGECKQVMQGHTNEVLCLSVTSNDK 729 Query: 180 MMVTCSKDRSIXVWDMTS 233 +V+ S D + VW++ + Sbjct: 730 TIVSGSNDFTARVWNVAT 747 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 6/91 (6%) Frame = +3 Query: 12 LQGHTGSVLCL--QYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC--NG 179 L+GH G + CL +D + I+SG+ D+ ++VWD+ TL H + + + Sbjct: 416 LKGHGGLIKCLAAMHDGKRIVSGAKDNNIKVWDLVRLECQATLKGHTSLIWAIAVSRDDS 475 Query: 180 MMVTCSKDRSIXVWDMTS--TTEIMLXECWW 266 ++V+ SKD + VW S T+ ++ W Sbjct: 476 VIVSASKDDLLKVWRTESWVCTQTLIGHSSW 506 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 2/72 (2%) Frame = +2 Query: 299 DEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRD--RLVVSGSSDNTIRLXD 472 D +VS S D T+++ + L GH G+ L + R +VSGS D+TIRL D Sbjct: 643 DGTQVVSGSADGTVRLHSVLRDRDGMVLRGHDKGVTALLIMNDCRHLVSGSKDSTIRLWD 702 Query: 473 IECXSCIXVLEG 508 + C V++G Sbjct: 703 LTKGECKQVMQG 714 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +2 Query: 311 IVSASGDRTIKVWNTSSCEFVRTLNGHKXGI-ACLQYRDRLVVSGSSDNTIRLXDIECXS 487 +V+ D + WN S + + GH+ I A L V+SGS D+T+R D+E Sbjct: 311 VVTGCADHVARSWNAKSGKMMLEFRGHEGAINAILVTAKDWVISGSDDSTVRAWDLENGE 370 Query: 488 CIXVLEGGPVPNFAL 532 V +G P L Sbjct: 371 SCAVFQGHSKPVLCL 385 Score = 41.5 bits (93), Expect = 0.001 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 4/74 (5%) Frame = +3 Query: 21 HTGSVLCLQY--DERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGM--MV 188 H G+V C Q D ++SGS+D TVR+ V L H + V L N +V Sbjct: 631 HDGAVTCAQVTQDGTQVVSGSADGTVRLHSVLRDRDGMVLRGHDKGVTALLIMNDCRHLV 690 Query: 189 TCSKDRSIXVWDMT 230 + SKD +I +WD+T Sbjct: 691 SGSKDSTIRLWDLT 704 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/74 (29%), Positives = 43/74 (58%), Gaps = 6/74 (8%) Frame = +3 Query: 30 SVLCLQY--DERAIISGS--SDSTVRVWDVSTGAMLNTLIHHCEAVLHLRF--CNGMMVT 191 SV+C+ D+ I GS + +R++D+S+G ++ L H AV+ + + M+V+ Sbjct: 759 SVMCVTITNDDCCFIVGSHTNHQQLRMFDISSGKLVKDLNAHTHAVMRIELLRAHNMLVS 818 Query: 192 CSKDRSIXVWDMTS 233 S+D ++ VWD+ + Sbjct: 819 SSRDGTVKVWDVAN 832 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 4/77 (5%) Frame = +2 Query: 260 LVGHRAAVNVVDF--DEKYIVSASGDRTIKVWNTSSCEFVRTL--NGHKXGIACLQYRDR 427 L GH ++ V D+K+IV++ GD I +WNT + + + TL G L DR Sbjct: 210 LHGHTQRLDCVTVTRDDKFIVTSGGDSLINIWNTENHDCIHTLKIGGKGQSHLVLTNDDR 269 Query: 428 LVVSGSSDNTIRLXDIE 478 VV+ ++D++ DI+ Sbjct: 270 FVVA-AADSSFGAWDID 285 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/71 (26%), Positives = 35/71 (49%) Frame = +2 Query: 287 VVDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLVVSGSSDNTIRL 466 +VDF K + A+ D +K+W+ + E + T + + + VV+GSSD ++L Sbjct: 560 MVDFGRKGVSGANEDN-LKIWDMRTQECIITKPASVSCVTRVATSPK-VVTGSSDGEMKL 617 Query: 467 XDIECXSCIXV 499 D C+ + Sbjct: 618 WDCVTGECVTI 628 Score = 30.3 bits (65), Expect = 2.3 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 10/82 (12%) Frame = +3 Query: 12 LQGHTGSVLCLQY--DERAIISGSSDSTVRVWDV-------STGAMLNTLIHHCEAVLHL 164 L GH+ + C+ D + IISGS+D V++W + G + ++HH + + Sbjct: 500 LIGHSSWISCVAMTTDGKTIISGSNDKNVKMWYTHGNAHAQAIGVPSDHIMHHLDQPRCV 559 Query: 165 RFCNGMM-VTCSKDRSIXVWDM 227 G V+ + + ++ +WDM Sbjct: 560 MVDFGRKGVSGANEDNLKIWDM 581 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/69 (24%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = +3 Query: 21 HTGSVLCLQYD-ERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNGMMVTCS 197 H C+ D R +SG+++ +++WD+ T + T V + + +VT S Sbjct: 552 HLDQPRCVMVDFGRKGVSGANEDNLKIWDMRTQECIITKPASVSCVTRVA-TSPKVVTGS 610 Query: 198 KDRSIXVWD 224 D + +WD Sbjct: 611 SDGEMKLWD 619 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 63 IISGSSDSTVRVWDVSTGAMLNTLIHHCEAV 155 +++GSSD +++WD TG + T+ H AV Sbjct: 606 VVTGSSDGEMKLWDCVTGECV-TIARHDGAV 635 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSPLPNKXXXLKWRNGQXXXRLIFXLKFRVKF 767 +N GVTQLNRLAAH PFA W NSE AR D P L+ NG+ F L + Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP----SQQLRSLNGEWRLMRYFLLTHLCET 104 Query: 768 LVK 776 LVK Sbjct: 105 LVK 107 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSPLPNKXXXLKWRNGQXXXRLIFXLKFRVKF 767 +N GVTQLNRLAAH PFA W NSE AR D P L+ NG+ F L + Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP----SQQLRSLNGEWRLMRYFLLTHLCET 99 Query: 768 LVK 776 LVK Sbjct: 100 LVK 102 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 53.2 bits (122), Expect = 3e-07 Identities = 33/64 (51%), Positives = 35/64 (54%) Frame = -2 Query: 646 QXAKGXCAARRLSWVTPRFFRVHDVVKRRPVNXNTXXL*GEIGYRAPLEHXDARAALDVX 467 Q AKG CAARRLSW P HDVVKRRPVN NT YRA AAL++ Sbjct: 611 QLAKGGCAARRLSWGFPS----HDVVKRRPVNCNTTH------YRANWSSTAVAAALELV 660 Query: 466 QPDG 455 P G Sbjct: 661 DPPG 664 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSPLPNKXXXLKWRNGQXXXRLIFXLKFRVKF 767 +N GVTQLNRLAAH PFA W NSE AR D P L+ NG+ F L + Sbjct: 54 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP----SQQLRSLNGEWRLMRYFLLTHLCET 109 Query: 768 LVK 776 LVK Sbjct: 110 LVK 112 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSPLPNKXXXLKWRNGQXXXRLIFXLKFRVKF 767 +N GVTQLNRLAAH PFA W NSE AR D P L+ NG+ F L + Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP----SQQLRSLNGEWRLMRYFLLTHLCET 101 Query: 768 LVK 776 LVK Sbjct: 102 LVK 104 >SB_54574| Best HMM Match : WD40 (HMM E-Value=0) Length = 1050 Score = 53.2 bits (122), Expect = 3e-07 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 4/75 (5%) Frame = +3 Query: 12 LQGHTGSVLC--LQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC--NG 179 + GH V C +D+ IIS S+D TV++WD S+G + + H + V F + Sbjct: 548 ISGHGDVVNCCAFSHDDSRIISCSADQTVKIWDASSGEGVLCFVGHTQEVFSCSFSPDDT 607 Query: 180 MMVTCSKDRSIXVWD 224 V+CS DR++ VWD Sbjct: 608 KAVSCSADRTVKVWD 622 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 4/84 (4%) Frame = +3 Query: 18 GHTGSVLCLQY--DERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC--NGMM 185 GHT V + D+ +S S+D TV+VWD TG + + H + V F G + Sbjct: 592 GHTQEVFSCSFSPDDTKAVSCSADRTVKVWDSKTGVCYHVYMAHTDIVRWCCFSPDGGKV 651 Query: 186 VTCSKDRSIXVWDMTSTTEIMLXE 257 +CS D ++ +W+ +S ++ L + Sbjct: 652 ASCSDDNTVRIWEASSGEDLCLLD 675 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/75 (29%), Positives = 43/75 (57%), Gaps = 4/75 (5%) Frame = +3 Query: 21 HTGSVLCLQY--DERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCN--GMMV 188 H G+V C ++ D ++S +D+ V+VWD +G L ++ H + V F + ++ Sbjct: 509 HCGAVYCCKFSSDSSKVVSCGTDNHVKVWDSQSGRQLLSISGHGDVVNCCAFSHDDSRII 568 Query: 189 TCSKDRSIXVWDMTS 233 +CS D+++ +WD +S Sbjct: 569 SCSADQTVKIWDASS 583 Score = 48.0 bits (109), Expect = 1e-05 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 4/82 (4%) Frame = +2 Query: 266 GHRAAVNVVDF--DEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYR--DRLV 433 GH VN F D+ I+S S D+T+K+W+ SS E V GH + + D Sbjct: 550 GHGDVVNCCAFSHDDSRIISCSADQTVKIWDASSGEGVLCFVGHTQEVFSCSFSPDDTKA 609 Query: 434 VSGSSDNTIRLXDIECXSCIXV 499 VS S+D T+++ D + C V Sbjct: 610 VSCSADRTVKVWDSKTGVCYHV 631 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 1/69 (1%) Frame = +3 Query: 42 LQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFC-NGMMVTCSKDRSIXV 218 + +D + +IS S+D +VWD STG +L +L H + V + F + M+ T D + + Sbjct: 935 VSHDSQRLISASADCFAKVWDASTGELLLSLGRHPDVVRSISFSPDNMICTGCDDGIVRI 994 Query: 219 WDMTSTTEI 245 WD S E+ Sbjct: 995 WDSVSGKEV 1003 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +2 Query: 290 VDFDEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYR-DRLVVSGSSDNTIRL 466 V D + ++SAS D KVW+ S+ E + +L H + + + D ++ +G D +R+ Sbjct: 935 VSHDSQRLISASADCFAKVWDASTGELLLSLGRHPDVVRSISFSPDNMICTGCDDGIVRI 994 Query: 467 XD 472 D Sbjct: 995 WD 996 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 4/72 (5%) Frame = +2 Query: 269 HRAAVNVVDF--DEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIAC--LQYRDRLVV 436 H AV F D +VS D +KVW++ S + +++GH + C + D ++ Sbjct: 509 HCGAVYCCKFSSDSSKVVSCGTDNHVKVWDSQSGRQLLSISGHGDVVNCCAFSHDDSRII 568 Query: 437 SGSSDNTIRLXD 472 S S+D T+++ D Sbjct: 569 SCSADQTVKIWD 580 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = +3 Query: 39 CLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCN-GMMVTCSKDRSIX 215 C D + S S D+TVR+W+ S+G L L H +V F N G V I Sbjct: 643 CFSPDGGKVASCSDDNTVRIWEASSGEDLCLLDDHTSSVSFCCFMNQGESVVTVCSNCIK 702 Query: 216 VWDMTS 233 VW +S Sbjct: 703 VWSCSS 708 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/62 (24%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = +2 Query: 299 DEKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGI--ACLQYRDRLVVSGSSDNTIRLXD 472 D+ + D T+++WN+ + + GHK + +VSGS D T+++ Sbjct: 729 DDSIVAMGFSDTTVQLWNSKTFARLGVYKGHKGWAHSVGISKDSSKLVSGSEDETVKIWT 788 Query: 473 IE 478 I+ Sbjct: 789 ID 790 Score = 29.1 bits (62), Expect = 5.4 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +3 Query: 102 DVSTGAMLNTLIHHCEAVLHLRFCN--GMMVTCSKDRSIXVWDMTSTTEIM 248 D +L T HC AV +F + +V+C D + VWD S +++ Sbjct: 496 DTLDSRLLITAKVHCGAVYCCKFSSDSSKVVSCGTDNHVKVWDSQSGRQLL 546 Score = 28.7 bits (61), Expect = 7.1 Identities = 16/64 (25%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = +3 Query: 36 LCLQYDERAIISGSSDSTVRVWDVSTGAMLNTLIHH--CEAVLHLRFCNGMMVTCSKDRS 209 L D+ + G SD+TV++W+ T A L H + + + +V+ S+D + Sbjct: 724 LAFSPDDSIVAMGFSDTTVQLWNSKTFARLGVYKGHKGWAHSVGISKDSSKLVSGSEDET 783 Query: 210 IXVW 221 + +W Sbjct: 784 VKIW 787 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +3 Query: 15 QGHTGSV--LCLQYDERAIISGSSDSTVRVWDVSTGA 119 +GH G + + D ++SGS D TV++W + A Sbjct: 757 KGHKGWAHSVGISKDSSKLVSGSEDETVKIWTIDRDA 793 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSPLPNKXXXLKWRNGQXXXRLIFXLKFRVKF 767 +N GVTQLNRLAAH PFA W NSE AR D P L+ NG+ F L + Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP----SQQLRSLNGEWRLMRYFLLTHLCET 104 Query: 768 LVK 776 LVK Sbjct: 105 LVK 107 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSPLPNKXXXLKWRNGQXXXRLIFXLKFRVKF 767 +N GVTQLNRLAAH PFA W NSE AR D P L+ NG+ F L + Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP----SQQLRSLNGEWRLMRYFLLTHLCET 85 Query: 768 LVK 776 LVK Sbjct: 86 LVK 88 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSPLPNKXXXLKWRNGQXXXRLIFXLKFRVKF 767 +N GVTQLNRLAAH PFA W NSE AR D P L+ NG+ F L + Sbjct: 31 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP----SQQLRSLNGEWRLMRYFLLTHLCET 86 Query: 768 LVK 776 LVK Sbjct: 87 LVK 89 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSPLPNKXXXLKWRNGQXXXRLIFXLKFRVKF 767 +N GVTQLNRLAAH PFA W NSE AR D P L+ NG+ F L + Sbjct: 47 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP----SQQLRSLNGEWRLMRYFLLTHLCET 102 Query: 768 LVK 776 LVK Sbjct: 103 LVK 105 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSPLPNKXXXLKWRNGQXXXRLIFXLKFRVKF 767 +N GVTQLNRLAAH PFA W NSE AR D P L+ NG+ F L + Sbjct: 31 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP----SQQLRSLNGEWRLMRYFLLTHLCET 86 Query: 768 LVK 776 LVK Sbjct: 87 LVK 89 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 53.2 bits (122), Expect = 3e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 KN GVTQLNRLAAH PFA W NSE AR D P Sbjct: 18 KNPGVTQLNRLAAHPPFASWRNSEEARTDRP 48 Score = 37.5 bits (83), Expect = 0.015 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +2 Query: 542 RIXIHWPSFYNVVNSEKPG 598 RI IHWPSFYNVV + PG Sbjct: 3 RITIHWPSFYNVVTGKNPG 21 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 53.2 bits (122), Expect = 3e-07 Identities = 33/64 (51%), Positives = 35/64 (54%) Frame = -2 Query: 646 QXAKGXCAARRLSWVTPRFFRVHDVVKRRPVNXNTXXL*GEIGYRAPLEHXDARAALDVX 467 Q AKG CAARRLSW P HDVVKRRPVN NT YRA AAL++ Sbjct: 54 QLAKGGCAARRLSWGFPS----HDVVKRRPVNCNTTH------YRANWSSTAVAAALELV 103 Query: 466 QPDG 455 P G Sbjct: 104 DPPG 107 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSPLPNKXXXLKWRNGQXXXRLIFXLKFRVKF 767 +N GVTQLNRLAAH PFA W NSE AR D P L+ NG+ F L + Sbjct: 64 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP----SQQLRSLNGEWRLMRYFLLTHLCET 119 Query: 768 LVK 776 LVK Sbjct: 120 LVK 122 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 53.2 bits (122), Expect = 3e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 KN GVTQLNRLAAH PFA W NSE AR D P Sbjct: 49 KNPGVTQLNRLAAHPPFASWRNSEEARTDRP 79 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 P SY NSLAVVLQRR+ W P + L P Sbjct: 30 PYSESYYNSLAVVLQRRD----WKNPGVTQLNRLAAHP 63 >SB_25576| Best HMM Match : WD40 (HMM E-Value=1.6e-30) Length = 326 Score = 52.8 bits (121), Expect = 4e-07 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 2/71 (2%) Frame = +2 Query: 302 EKYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACL--QYRDRLVVSGSSDNTIRLXDI 475 E +V++S D T+KVW+ + +F RTL GH + L + + + S S+D TI+L D Sbjct: 73 ESVMVTSSEDATVKVWDYETGDFERTLKGHTDAVQDLAFDHTGKFLASSSADMTIKLWDF 132 Query: 476 ECXSCIXVLEG 508 + CI L G Sbjct: 133 QGFECIRTLHG 143 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = +3 Query: 54 ERAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRF--CNGMMVTCSKDRSIXVWD 224 E +++ S D+TV+VWD TG TL H +AV L F + + S D +I +WD Sbjct: 73 ESVMVTSSEDATVKVWDYETGDFERTLKGHTDAVQDLAFDHTGKFLASSSADMTIKLWD 131 Score = 42.3 bits (95), Expect = 5e-04 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 2/79 (2%) Frame = +2 Query: 260 LVGHRAAVNVVDFDE--KYIVSASGDRTIKVWNTSSCEFVRTLNGHKXGIACLQYRDRLV 433 L GH AV + FD K++ S+S D TIK+W+ E +RTL+G L+ Sbjct: 99 LKGHTDAVQDLAFDHTGKFLASSSADMTIKLWDFQGFECIRTLHG------------SLI 146 Query: 434 VSGSSDNTIRLXDIECXSC 490 S S+D TIR+ + C Sbjct: 147 ASCSNDQTIRVWVVASREC 165 Score = 38.3 bits (85), Expect = 0.009 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 2/78 (2%) Frame = +3 Query: 6 RELQGHTGSVLCLQYDE--RAIISGSSDSTVRVWDVSTGAMLNTLIHHCEAVLHLRFCNG 179 R L+GHT +V L +D + + S S+D T+++WD C LH Sbjct: 97 RTLKGHTDAVQDLAFDHTGKFLASSSADMTIKLWDFQG--------FECIRTLH----GS 144 Query: 180 MMVTCSKDRSIXVWDMTS 233 ++ +CS D++I VW + S Sbjct: 145 LIASCSNDQTIRVWVVAS 162 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 63 IISGSSDSTVRVWDVSTGAMLNTL 134 ++S S D ++++WDVS G L TL Sbjct: 209 LVSASRDKSIKIWDVSAGVCLVTL 232 >SB_53953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 52.8 bits (121), Expect = 4e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR+D P Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARSDRP 48 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 52.8 bits (121), Expect = 4e-07 Identities = 28/43 (65%), Positives = 29/43 (67%) Frame = +1 Query: 586 GKTWALPNLIALQHXPLSPXGLIAKXPATIRPFPTNXXX*NGE 714 GKT ALPNLIALQH PLSP G+IAK PA I P NGE Sbjct: 17 GKTLALPNLIALQHIPLSPAGVIAKRPAPI-ALPKQLRSLNGE 58 Score = 32.3 bits (70), Expect = 0.58 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +2 Query: 542 RIXIHWPSFYNVVNSE 589 RI IHWPSFYNVV + Sbjct: 3 RITIHWPSFYNVVTGK 18 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 52 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 82 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 33 PYSESYYNSLAVVLQRRDWENT 54 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 45 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 75 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 64 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 94 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 45 PYSESYYNSLAVVLQRRDWENT 66 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 100 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 130 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKTWALPNLIALQHXP 633 P SY NSLAVVLQRR+ G+ + L L P Sbjct: 20 PYSESYYNSLAVVLQRRD-GENTGVTQLNRLAAHP 53 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 52 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 82 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 61 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 91 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 42 PYSESYYNSLAVVLQRRDWENT 63 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 62 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 92 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 43 PYSESYYNSLAVVLQRRDWENT 64 >SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) Length = 241 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 161 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 191 >SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 38 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 68 >SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 >SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 67 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 97 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 48 PYSESYYNSLAVVLQRRDWENT 69 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 56 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 86 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 37 PYSESYYNSLAVVLQRRDWENT 58 >SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) Length = 499 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 418 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 448 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 105 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 135 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 86 PYSESYYNSLAVVLQRRDWENT 107 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 47 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 77 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 28 PYSESYYNSLAVVLQRRDWENT 49 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 45 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 75 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 26 PYSESYYNSLAVVLQRRDWENT 47 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 525 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 555 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 646 QXAKGXCAARRLSWVTPRF 590 Q AKG CAARRLSWVTP F Sbjct: 201 QLAKGGCAARRLSWVTPGF 219 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 506 PYSESYYNSLAVVLQRRDWENT 527 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 77 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 107 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 58 PYSESYYNSLAVVLQRRDWENT 79 >SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 46 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 76 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 27 PYSESYYNSLAVVLQRRDWENT 48 >SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 66 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 96 >SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) Length = 148 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 67 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 97 >SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 66 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 96 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 59 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 89 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 40 PYSESYYNSLAVVLQRRDWENT 61 >SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 46 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 76 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 27 PYSESYYNSLAVVLQRRDWENT 48 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 65 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 95 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 46 PYSESYYNSLAVVLQRRDWENT 67 >SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 94 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 124 >SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 76 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 106 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 81 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 111 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 62 PYSESYYNSLAVVLQRRDWENT 83 >SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 1375 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 1405 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 1356 PYSESYYNSLAVVLQRRDWENT 1377 >SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) Length = 248 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 168 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 198 >SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 51 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 81 >SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 69 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 99 >SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 47 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 77 >SB_14731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 199 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 229 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 180 PYSESYYNSLAVVLQRRDWENT 201 >SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 97 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 127 >SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 73 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 103 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 52.4 bits (120), Expect = 5e-07 Identities = 24/34 (70%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Frame = -1 Query: 680 GRIV-AGXFAIKPXGERGMCCKAIKLGNAQVFPS 582 GR + AG FAI P GERGMCCK+IKL +A VFPS Sbjct: 8 GRAIGAGLFAITPAGERGMCCKSIKLAHASVFPS 41 Score = 36.7 bits (81), Expect = 0.027 Identities = 27/79 (34%), Positives = 32/79 (40%) Frame = -2 Query: 691 LLGRGEXXXXXXXXSQXAKGXCAARRLSWVTPRFFRVHDVVKRRPVNXNTXXL*GEIGYR 512 LLGR +G C + + F HDVVKRRPVN NT YR Sbjct: 6 LLGRAIGAGLFAITPAGERGMCC-KSIKLAHASVFPSHDVVKRRPVNCNTTH------YR 58 Query: 511 APLEHXDARAALDVXQPDG 455 A AAL++ P G Sbjct: 59 ANWSSTAVAAALELVDPPG 77 >SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 48 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 78 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 105 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 135 >SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 81 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 111 >SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 58 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 88 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 39 PYSESYYNSLAVVLQRRDWENT 60 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 47 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 77 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 28 PYSESYYNSLAVVLQRRDWENT 49 >SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) Length = 181 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 100 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 130 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 81 PYSESYYNSLAVVLQRRDWENT 102 >SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_57755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 >SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 71 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 101 >SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 57 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 87 Score = 29.1 bits (62), Expect = 5.4 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = +1 Query: 445 LGQHHPAVGHRVXLVHPGARGGPGTQFRPIVXSYXNSLAVVLQRRELGKT 594 +G + + G + L P R + P SY NSLAVVLQRR+ T Sbjct: 13 IGSNSCSPGDPLVLERPPPRWSSNS---PYSESYYNSLAVVLQRRDWENT 59 >SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) Length = 175 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 94 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 124 >SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 48 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 78 >SB_54475| Best HMM Match : Adeno_VII (HMM E-Value=9.4) Length = 165 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 84 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 114 >SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 51 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 81 >SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 75 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 105 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 56 PYSESYYNSLAVVLQRRDWENT 77 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 98 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 128 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 79 PYSESYYNSLAVVLQRRDWENT 100 >SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 146 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 176 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 63 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 93 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 44 PYSESYYNSLAVVLQRRDWENT 65 >SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_48979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 >SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 107 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 137 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 88 PYSESYYNSLAVVLQRRDWENT 109 >SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 51 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 81 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 32 PYSESYYNSLAVVLQRRDWENT 53 >SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 55 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 85 Score = 29.5 bits (63), Expect = 4.1 Identities = 23/57 (40%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +1 Query: 430 RRVGVL--GQHHPAVGHRVXLVHPGARGGPGTQFRPIVXSYXNSLAVVLQRRELGKT 594 RR GV G + + G + L P R + P SY NSLAVVLQRR+ T Sbjct: 4 RRGGVADGGSNSCSPGDPLVLERPPPRWSSNS---PYSESYYNSLAVVLQRRDWENT 57 >SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 61 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 91 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 42 PYSESYYNSLAVVLQRRDWENT 63 >SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 76 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 106 >SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 48 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 78 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 29 PYSESYYNSLAVVLQRRDWENT 50 >SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 49 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 79 >SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 47 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 77 >SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 85 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 115 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 66 PYSESYYNSLAVVLQRRDWENT 87 >SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 59 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 89 >SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 65 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 95 >SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 52.4 bits (120), Expect = 5e-07 Identities = 27/54 (50%), Positives = 33/54 (61%) Frame = -1 Query: 713 SPFQXXXFVGKGRIVAGXFAIKPXGERGMCCKAIKLGNAQVFPSSRRCKTTASE 552 SPF+ +G+ I AG FAI P GERGMCCKAIKL V P++ + T E Sbjct: 10 SPFRLRKLLGRA-IGAGLFAITPAGERGMCCKAIKLVGKPVVPAALMNRPTRGE 62 >SB_37837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_36825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 66 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 96 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 47 PYSESYYNSLAVVLQRRDWENT 68 >SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 68 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 98 >SB_35598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 250 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 170 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 200 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 151 PYSESYYNSLAVVLQRRDWENT 172 >SB_34794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 >SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 60 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 90 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/53 (37%), Positives = 27/53 (50%) Frame = +1 Query: 436 VGVLGQHHPAVGHRVXLVHPGARGGPGTQFRPIVXSYXNSLAVVLQRRELGKT 594 +G +G + + G + L P R + P SY NSLAVVLQRR+ T Sbjct: 13 IGEVGSNSCSPGDPLVLERPPPRWSSNS---PYSESYYNSLAVVLQRRDWENT 62 >SB_33898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_33514| Best HMM Match : DUF503 (HMM E-Value=1.6) Length = 223 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 142 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 172 >SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 67 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 97 >SB_32886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 47 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 77 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 128 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 158 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 109 PYSESYYNSLAVVLQRRDWENT 130 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 115 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 145 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 96 PYSESYYNSLAVVLQRRDWENT 117 >SB_29948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_29695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 68 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 98 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 80 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 110 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 61 PYSESYYNSLAVVLQRRDWENT 82 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 64 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 94 >SB_27907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_27247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 57 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 87 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 45 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 75 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 26 PYSESYYNSLAVVLQRRDWENT 47 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 67 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 97 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 48 PYSESYYNSLAVVLQRRDWENT 69 >SB_26184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_25988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 54 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 84 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 35 PYSESYYNSLAVVLQRRDWENT 56 >SB_25331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 61 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 91 >SB_24868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_22584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 50 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 80 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 31 PYSESYYNSLAVVLQRRDWENT 52 >SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 55 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 85 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 53 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 83 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 34 PYSESYYNSLAVVLQRRDWENT 55 >SB_21002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 54 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 84 >SB_20750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_19937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 52 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 82 >SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 133 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 163 Score = 29.5 bits (63), Expect = 4.1 Identities = 19/45 (42%), Positives = 22/45 (48%) Frame = +1 Query: 460 PAVGHRVXLVHPGARGGPGTQFRPIVXSYXNSLAVVLQRRELGKT 594 P G + L P R + P SY NSLAVVLQRR+ T Sbjct: 94 PGPGDPLVLERPPPRWSSNS---PYSESYYNSLAVVLQRRDWENT 135 >SB_19365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 44 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 74 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 623 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 653 Score = 30.3 bits (65), Expect = 2.3 Identities = 21/48 (43%), Positives = 24/48 (50%) Frame = +1 Query: 451 QHHPAVGHRVXLVHPGARGGPGTQFRPIVXSYXNSLAVVLQRRELGKT 594 Q HP G + L P R + P SY NSLAVVLQRR+ T Sbjct: 583 QQHP--GDPLVLERPPPRWSSNS---PYSESYYNSLAVVLQRRDWENT 625 >SB_18964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_18148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 57 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 87 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 115 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 145 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 96 PYSESYYNSLAVVLQRRDWENT 117 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 95 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 125 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 76 PYSESYYNSLAVVLQRRDWENT 97 >SB_17776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 48 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 78 >SB_16561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 58 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 88 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 39 PYSESYYNSLAVVLQRRDWENT 60 >SB_14675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 57 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 87 >SB_14548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_14046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_13642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 58 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 88 >SB_13143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 202 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 232 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 183 PYSESYYNSLAVVLQRRDWENT 204 >SB_12757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 47 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 77 >SB_11792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 18 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 48 >SB_11340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 78 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 108 >SB_10857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 146 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 176 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 51 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 81 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 32 PYSESYYNSLAVVLQRRDWENT 53 >SB_10117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_10054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 705 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 735 Score = 28.7 bits (61), Expect = 7.1 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKTWALPNLIALQHXP 633 P SY NSLAVVLQRR+ G+ + L L P Sbjct: 686 PYSESYYNSLAVVLQRRD-GENTGVTQLNRLAAHP 719 >SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 101 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 131 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 56 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 86 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 37 PYSESYYNSLAVVLQRRDWENT 58 >SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 64 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 94 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 45 PYSESYYNSLAVVLQRRDWENT 66 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 79 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 109 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 60 PYSESYYNSLAVVLQRRDWENT 81 >SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 57 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 87 Score = 29.1 bits (62), Expect = 5.4 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = +1 Query: 445 LGQHHPAVGHRVXLVHPGARGGPGTQFRPIVXSYXNSLAVVLQRRELGKT 594 +G + + G + L P R + P SY NSLAVVLQRR+ T Sbjct: 13 IGSNSCSPGDPLVLERPPPRWSSNS---PYSESYYNSLAVVLQRRDWENT 59 >SB_7369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_6429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 62 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 92 >SB_5748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 48 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 78 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 29 PYSESYYNSLAVVLQRRDWENT 50 >SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 45 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 75 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 26 PYSESYYNSLAVVLQRRDWENT 47 >SB_4254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_3679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 59 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 89 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 48 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 78 Score = 29.1 bits (62), Expect = 5.4 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = +1 Query: 442 VLGQHHPAVGHRVXLVHPGARGGPGTQFRPIVXSYXNSLAVVLQRRELGKT 594 VL + + G + L P R + P SY NSLAVVLQRR+ T Sbjct: 3 VLASNSCSPGDPLVLERPPPRWSSNS---PYSESYYNSLAVVLQRRDWENT 50 >SB_1518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 20 PYSESYYNSLAVVLQRRDWENT 41 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 76 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 106 >SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 63 ENTGVTQLNRLAAHPPFASWRNSEEARTDRP 93 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKT 594 P SY NSLAVVLQRR+ T Sbjct: 44 PYSESYYNSLAVVLQRRDWENT 65 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 45 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 75 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 541 SYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 SY NSLAVVLQRR+ W P + L P Sbjct: 30 SYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 59 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 25 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 55 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 P SY NSLAVVLQRR+ W P + L P Sbjct: 20 PYSESYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 53 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 102 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 54 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 84 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 P SY NSLAVVLQRR+ W P + L P Sbjct: 35 PYSESYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 68 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 76 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 541 SYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 SY NSLAVVLQRR+ W P + L P Sbjct: 31 SYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 60 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 102 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 541 SYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 SY NSLAVVLQRR+ W P + L P Sbjct: 57 SYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 86 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 77 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 107 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 P SY NSLAVVLQRR+ W P + L P Sbjct: 58 PYSESYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 91 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 48 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 78 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 541 SYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 SY NSLAVVLQRR+ W P + L P Sbjct: 33 SYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 62 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 98 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 P SY NSLAVVLQRR+ W P + L P Sbjct: 49 PYSESYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 82 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 80 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 110 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 541 SYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 SY NSLAVVLQRR+ W P + L P Sbjct: 65 SYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 94 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 69 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 P SY NSLAVVLQRR+ W P + L P Sbjct: 20 PYSESYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 53 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 56 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 86 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 541 SYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 SY NSLAVVLQRR+ W P + L P Sbjct: 41 SYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 70 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 45 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 75 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 P SY NSLAVVLQRR+ W P + L P Sbjct: 26 PYSESYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 59 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 35 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 65 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 60 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 90 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 P SY NSLAVVLQRR+ W P + L P Sbjct: 41 PYSESYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 74 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 69 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 99 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 529 PIVXSYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 P SY NSLAVVLQRR+ W P + L P Sbjct: 50 PYSESYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 83 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 63 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 93 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 541 SYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 SY NSLAVVLQRR+ W P + L P Sbjct: 48 SYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 77 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 79 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 109 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 541 SYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 SY NSLAVVLQRR+ W P + L P Sbjct: 64 SYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 93 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 588 KNLGVTQLNRLAAHXPFAXWLNSEXARNDSP 680 +N GVTQLNRLAAH PFA W NSE AR D P Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSEEARTDRP 97 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 541 SYXNSLAVVLQRRELGKTWALPNLIALQHXPLSP 642 SY NSLAVVLQRR+ W P + L P Sbjct: 52 SYYNSLAVVLQRRD----WENPGVTQLNRLAAHP 81 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,340,966 Number of Sequences: 59808 Number of extensions: 446950 Number of successful extensions: 8538 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8441 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2717121828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -