BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0262.Seq (932 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 22 6.9 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 6.9 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.2 bits (45), Expect = 6.9 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +3 Query: 90 VRVWDVSTGAMLNTLIHHCEAVLHLRFCNGMMV 188 + WD +T NT I E + FCN + + Sbjct: 321 IACWDTNTELNPNTFILVAENNTTMVFCNDLSI 353 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 22.2 bits (45), Expect = 6.9 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 Query: 269 HRAAVNVVDFDEKYI 313 HR N D+D KYI Sbjct: 225 HRLTSNTFDYDPKYI 239 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,251 Number of Sequences: 438 Number of extensions: 3992 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30476628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -