BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0258.Seq (900 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) 99 6e-21 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) 24 3.6 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 29 3.9 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 28 8.9 SB_43823| Best HMM Match : MAM (HMM E-Value=0) 28 8.9 SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) 28 8.9 >SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) Length = 710 Score = 98.7 bits (235), Expect = 6e-21 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +1 Query: 46 TTMGDIEDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKV 225 T ++ DT F +G+SGAS T+P QCS+LRKNG V++KGRPCKIVEMSTSKTGKHGHAKV Sbjct: 585 TMAEELADTEFHSGESGASDTYPAQCSSLRKNGHVVIKGRPCKIVEMSTSKTGKHGHAKV 644 Score = 70.5 bits (165), Expect = 2e-12 Identities = 29/62 (46%), Positives = 44/62 (70%) Frame = +3 Query: 324 QLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKELLCTVLKSCGEECVIA 503 ++T+I +DGYL LM DNGD R D+K+ D D+ ++R F++ + + TVLK+ GEE V+ Sbjct: 643 KVTNIEEDGYLELMDDNGDTRADIKLQDNDIAKEIRAKFEASENFMVTVLKAMGEETVVG 702 Query: 504 VK 509 VK Sbjct: 703 VK 704 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -3 Query: 523 ESC--VCLTAMTHSSPQDFSTVHNNSLPLSKSVRNCVPRSPS 404 +SC +C T+ S P + H+N+ P S NC P PS Sbjct: 1285 QSCPKICFTSCKPSCPVHCCSEHSNACPQECSTDNCKPSCPS 1326 >SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 136 KNGFVMLKGRPCKIV-EMSTSKTGKHGHAKVHLVGIDIFNGKSMKISVPPH 285 + G +M +G+PCKI + K G HG +H+ G D NG +S PH Sbjct: 17 RRGVMMAEGKPCKITGTIEGLKAGNHGF-HIHVYG-DNTNG---CVSAGPH 62 >SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) Length = 458 Score = 24.2 bits (50), Expect(2) = 3.6 Identities = 13/54 (24%), Positives = 26/54 (48%) Frame = +2 Query: 110 SPCNVRPCVKMVSLC*RVVHARLLKCPHPKPESTATLKFTWLGLISSMEKV*RY 271 +PC ++ C + +S+ V ++K P P TL ++G + K+ +Y Sbjct: 398 NPCRIQYCTQEISMTPIHVLLLIVKAPILDPSLVVTLCSRFIGHQARKLKIVKY 451 Score = 23.8 bits (49), Expect(2) = 3.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 92 PGPQPPSPCNVRP 130 PGPQ P P N+ P Sbjct: 362 PGPQDPGPGNILP 374 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +2 Query: 11 HISFLTVVKFKTQQWVTSKTHTLRPETPGPQPPSPCNVRPC 133 H L K KT + T+K +T +P T P+ P +PC Sbjct: 92 HTIKLYTTKPKTTKPHTNKPYTTKPRTTKPRTTKPHTTKPC 132 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 59 TSKTHTLRPETPGPQPPSPCNVRPCVKMVSLC*RVVH-ARLLKCPH 193 T+K HT +P T P P N+ P + +L ++H + PH Sbjct: 168 TTKPHTTKPHTTKPHTTKPHNIDPTLPSPTLLNALLHFLYFYQAPH 213 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -3 Query: 484 PQDFSTVHNNSLPLSKSVRNCVPRSPSGILRSSRRSPLSAIRVR 353 P+ S V + +LP+ V C+P SPS I RS P VR Sbjct: 253 PRQISNVRSLTLPVRYQVIGCLP-SPSDIKRSVPYPPRQISNVR 295 >SB_43823| Best HMM Match : MAM (HMM E-Value=0) Length = 1724 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = -3 Query: 148 RNHFYAGPNIAW--GRWLRPRSLRSQSV 71 R F+ PN+A G+WL P+SLR+ V Sbjct: 947 REGFFNNPNLAGCKGQWLGPKSLRASRV 974 >SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) Length = 1058 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 26 TVVKFKTQQWVTSKTHTLRPETPGPQPPSPCNVRP 130 +VV + VT K T +P TP P P P RP Sbjct: 758 SVVAMPAARPVTPKPVTPKPVTPKPVTPKPVTTRP 792 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,194,233 Number of Sequences: 59808 Number of extensions: 594208 Number of successful extensions: 1786 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1778 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2586032617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -