BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0257.Seq (900 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0503 - 3981603-3981730,3982858-3983023,3983057-3983139,398... 29 6.7 08_01_0519 - 4518256-4519623,4520840-4521230,4521313-4521525,452... 29 6.7 01_07_0213 - 42028941-42029055,42029444-42029480,42029876-420302... 29 6.7 >12_01_0503 - 3981603-3981730,3982858-3983023,3983057-3983139, 3983250-3983301,3983497-3983654,3983756-3985617, 3986029-3986093,3986176-3986340,3986836-3986893, 3987479-3987590,3987661-3987712,3988080-3988140, 3988220-3988377,3988705-3988787,3988897-3988945, 3989122-3989185,3990225-3990317,3990410-3990543, 3991364-3991585,3991815-3991937,3992103-3992267, 3993064-3993450 Length = 1479 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 474 GELGTGPPPVSSQTFKQTRTSPRLH-GCDNRRVALASALRQETRKYDV 334 G G PPP SS + ++ R+ P H GCD+ V+L R K D+ Sbjct: 893 GSSGKPPPP-SSPSVRRVRSLPARHAGCDD--VSLVEKFRNAMAKRDL 937 >08_01_0519 - 4518256-4519623,4520840-4521230,4521313-4521525, 4521632-4521723,4522226-4522342,4522641-4522704, 4523175-4523228,4523579-4523666,4523788-4524023, 4525258-4525478,4525634-4525827,4525938-4525995, 4526771-4526824,4526851-4527473,4527580-4527640, 4528417-4528590,4528803-4529063,4529201-4529320, 4529388-4530022,4530062-4530828,4530915-4531012, 4531101-4531155,4531230-4531318 Length = 2010 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 317 PARRKSTSYFLVSCLSADASATRLLSQPCSLGLVRVCLNVCD 442 P RRK S L +S LSQ C+ G++ + L++CD Sbjct: 1319 PNRRKGESQELKQINPLHSSHLHALSQACAPGVILMPLDLCD 1360 >01_07_0213 - 42028941-42029055,42029444-42029480,42029876-42030244, 42030332-42031201,42051574-42052891 Length = 902 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = -2 Query: 515 CKRRPVNCNTTHYRANWVPGPPLYHRRRSNKHALVRDCTAATTDAS 378 CK R +C+T H ++ WVP R++ A TA+ AS Sbjct: 652 CKSRGFDCST-HVKSTWVPAARRRERQQLTGSASSSPATASAAAAS 696 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,539,453 Number of Sequences: 37544 Number of extensions: 487345 Number of successful extensions: 1139 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1138 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2542098580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -