BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0257.Seq (900 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY310330-1|AAQ76970.1| 158|Homo sapiens GPRA isoform D protein. 33 1.9 AY358206-1|AAQ88573.1| 280|Homo sapiens KTSR5831 protein. 30 10.0 >AY310330-1|AAQ76970.1| 158|Homo sapiens GPRA isoform D protein. Length = 158 Score = 32.7 bits (71), Expect = 1.9 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = -2 Query: 677 ILTLTILQFAIQXRNCWERANRCGPSSLLRQLAKGGCAARRLSWVTPGFSQSRR--CKRR 504 + TI+ ++ + W R + + + QLA GCAA RL ++ PG Q R+ C R Sbjct: 59 LFVFTIVGNSVVLFSTWRRKKKSRMTFFVTQLAITGCAALRL-YLRPGVPQHRQIPCHRL 117 Query: 503 P 501 P Sbjct: 118 P 118 >AY358206-1|AAQ88573.1| 280|Homo sapiens KTSR5831 protein. Length = 280 Score = 30.3 bits (65), Expect = 10.0 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 636 QLLGKGESVRAFFAITPAGERGMCCKAIKLGNARVFPVT 520 +L G GE R+F + PA E+G+ + +VF VT Sbjct: 112 ELSGLGEKCRSFIDLAPASEKGLLGMVAHMMYTQVFQVT 150 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,732,787 Number of Sequences: 237096 Number of extensions: 2497178 Number of successful extensions: 5402 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5402 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11603768198 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -