BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0241.Seq (534 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y09443-1|CAA70591.1| 658|Homo sapiens alkyl-dihydroxyacetonepho... 44 3e-04 BC141820-1|AAI41821.1| 658|Homo sapiens alkylglycerone phosphat... 44 3e-04 AY544121-1|AAT11152.1| 658|Homo sapiens aging-associated protei... 44 3e-04 AC073834-1|AAX93112.1| 143|Homo sapiens unknown protein. 44 3e-04 AB002317-1|BAA20777.2| 1109|Homo sapiens KIAA0319 protein. 33 0.84 >Y09443-1|CAA70591.1| 658|Homo sapiens alkyl-dihydroxyacetonephosphate synthase precursor protein. Length = 658 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = -2 Query: 173 EETIRLGGSMVHHHGIGKHRVXWSKLEHGS-AWALLEGLKKQFDPNGI 33 EE + GGS+ HHHG+GK R W K + +L+ +K+ DPN I Sbjct: 604 EEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNI 651 >BC141820-1|AAI41821.1| 658|Homo sapiens alkylglycerone phosphate synthase protein. Length = 658 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = -2 Query: 173 EETIRLGGSMVHHHGIGKHRVXWSKLEHGS-AWALLEGLKKQFDPNGI 33 EE + GGS+ HHHG+GK R W K + +L+ +K+ DPN I Sbjct: 604 EEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNI 651 >AY544121-1|AAT11152.1| 658|Homo sapiens aging-associated protein 5 protein. Length = 658 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = -2 Query: 173 EETIRLGGSMVHHHGIGKHRVXWSKLEHGS-AWALLEGLKKQFDPNGI 33 EE + GGS+ HHHG+GK R W K + +L+ +K+ DPN I Sbjct: 604 EEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNI 651 >AC073834-1|AAX93112.1| 143|Homo sapiens unknown protein. Length = 143 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = -2 Query: 173 EETIRLGGSMVHHHGIGKHRVXWSKLEHGS-AWALLEGLKKQFDPNGI 33 EE + GGS+ HHHG+GK R W K + +L+ +K+ DPN I Sbjct: 89 EEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNI 136 >AB002317-1|BAA20777.2| 1109|Homo sapiens KIAA0319 protein. Length = 1109 Score = 32.7 bits (71), Expect = 0.84 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 61 SPSSNAHALPCSSLLQXTRCLPIPW-WCTIEPPRRMVSSQMILLS 192 +P + L +SL R LP P WCT+ PP ++SS ++L++ Sbjct: 9 APKKHQRKLAPNSLQGRLRSLPSPTVWCTMAPPTGVLSSLLLLVT 53 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,137,173 Number of Sequences: 237096 Number of extensions: 1298968 Number of successful extensions: 2866 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2866 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 5216942984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -