BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0236.Seq (900 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 24 2.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 24 2.2 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 6.6 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.8 bits (49), Expect = 2.2 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 851 LIRELLFQTGNKXXTXSRXNLWIYKGFCRIRPN 753 LIR+ + ++ +K T + W FC R N Sbjct: 512 LIRQSIIESPDKQLTLNEIYNWFQNTFCYFRRN 544 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.8 bits (49), Expect = 2.2 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -3 Query: 412 VWSATSGLRTAS--PHRPRPASW*PHRAS 332 V+ +T+G S PH+ P+ + PHR S Sbjct: 304 VYPSTAGFLPPSYHPHQHHPSQYHPHRGS 332 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 421 TGYVWSATSGLRTASPHRPRPASW*P 344 T Y + G+R A+P P +W P Sbjct: 497 TLYKIARREGIRLAAPFNASPTTWSP 522 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,353 Number of Sequences: 438 Number of extensions: 4448 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29146299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -