BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0235.Seq (823 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 2e-26 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 3e-26 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 104 8e-23 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 104 8e-23 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 103 2e-22 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 102 3e-22 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 102 3e-22 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 4e-22 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 101 5e-22 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 5e-22 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 101 5e-22 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 101 5e-22 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 5e-22 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 7e-22 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 7e-22 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 7e-22 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 101 7e-22 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 7e-22 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 9e-22 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 9e-22 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 9e-22 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 101 9e-22 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 101 9e-22 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 9e-22 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 100 1e-21 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 100 1e-21 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 100 1e-21 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 2e-21 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 2e-21 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 2e-21 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 2e-21 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 2e-21 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 100 2e-21 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 2e-21 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 2e-21 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 100 2e-21 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 100 2e-21 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 2e-21 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 2e-21 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 99 2e-21 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 99 2e-21 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 99 2e-21 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 99 2e-21 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 99 2e-21 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 99 2e-21 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 99 2e-21 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 99 2e-21 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 99 2e-21 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 99 2e-21 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 99 2e-21 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 99 2e-21 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 99 2e-21 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 99 2e-21 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 99 2e-21 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 99 2e-21 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 99 2e-21 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 99 2e-21 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 99 2e-21 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 99 2e-21 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 99 2e-21 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 99 2e-21 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 99 2e-21 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 99 2e-21 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 99 2e-21 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 99 2e-21 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 99 2e-21 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 99 2e-21 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 99 2e-21 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 99 2e-21 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 99 2e-21 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 99 2e-21 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 99 2e-21 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 99 2e-21 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 99 2e-21 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 99 2e-21 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 99 2e-21 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 99 2e-21 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 99 2e-21 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 99 2e-21 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 99 2e-21 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 99 2e-21 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 99 2e-21 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 99 2e-21 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 99 2e-21 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 99 2e-21 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 99 2e-21 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 99 2e-21 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 99 2e-21 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 99 2e-21 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 99 2e-21 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 99 2e-21 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 99 2e-21 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 99 2e-21 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 99 2e-21 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 99 2e-21 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 99 2e-21 SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 99 2e-21 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 99 2e-21 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 99 2e-21 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 99 2e-21 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 99 2e-21 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 99 2e-21 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 99 2e-21 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 99 2e-21 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 99 2e-21 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 99 2e-21 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 99 2e-21 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 99 2e-21 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 99 2e-21 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 99 2e-21 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 99 2e-21 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 99 2e-21 SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 99 2e-21 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 99 2e-21 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 99 2e-21 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 99 2e-21 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 99 2e-21 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 99 2e-21 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 99 2e-21 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 99 2e-21 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 100 3e-21 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 100 3e-21 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 100 3e-21 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 100 3e-21 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 100 3e-21 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 100 3e-21 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 100 3e-21 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 100 3e-21 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 100 3e-21 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 99 4e-21 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 99 4e-21 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 99 4e-21 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 99 4e-21 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 99 4e-21 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 99 4e-21 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 99 4e-21 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 99 4e-21 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 99 4e-21 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 99 4e-21 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 99 4e-21 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 99 4e-21 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 99 4e-21 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 99 4e-21 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 99 4e-21 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 99 4e-21 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 116 bits (279), Expect = 2e-26 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 333 VSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 +SRITIHWP VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 329 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 116 bits (278), Expect = 3e-26 Identities = 51/57 (89%), Positives = 53/57 (92%) Frame = +3 Query: 321 IRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 IRPIVSRITIHWP +RRDWENPGV QLNRLAAHPPFASWR+SEEARTDRPSQQLR Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEEARTDRPSQQLR 74 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 107 bits (256), Expect = 1e-23 Identities = 49/58 (84%), Positives = 50/58 (86%) Frame = -3 Query: 491 AQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 318 AQLLGRAIGAGLFAITPAGERGMCCKAIKLGNA VFP + PVNCNTTHYRANW Sbjct: 10 AQLLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 104 bits (250), Expect = 8e-23 Identities = 53/78 (67%), Positives = 59/78 (75%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVI 341 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 63 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---A 117 Query: 340 RLTIGRIGYRAPPWKSIL 287 +L ++ R P++SIL Sbjct: 118 KLACLQVDSRGSPYESIL 135 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 104 bits (250), Expect = 8e-23 Identities = 48/64 (75%), Positives = 51/64 (79%) Frame = +3 Query: 300 QGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 479 QGG P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 51 QGGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 110 Query: 480 QQLR 491 QQLR Sbjct: 111 QQLR 114 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 103 bits (247), Expect = 2e-22 Identities = 49/69 (71%), Positives = 55/69 (79%) Frame = -1 Query: 490 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYR 311 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSR 59 Query: 310 APPWKSILI 284 P+ S++I Sbjct: 60 GSPYSSLII 68 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 103 bits (247), Expect = 2e-22 Identities = 50/81 (61%), Positives = 58/81 (71%) Frame = -1 Query: 517 LQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIR 338 + F ++ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT + Sbjct: 92 IPFVALLKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLAC 151 Query: 337 LTIGRIGYRAPPWKSILITRL 275 L + G P +L+ R+ Sbjct: 152 LQVDSRGSPGPKRNLLLLIRV 172 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 102 bits (245), Expect = 3e-22 Identities = 48/69 (69%), Positives = 52/69 (75%) Frame = +3 Query: 285 IRIDFQGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 464 + I F G P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR Sbjct: 34 LSIAFAGEGGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 93 Query: 465 TDRPSQQLR 491 TDRPSQQLR Sbjct: 94 TDRPSQQLR 102 >SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 102 bits (245), Expect = 3e-22 Identities = 52/86 (60%), Positives = 61/86 (70%), Gaps = 11/86 (12%) Frame = +3 Query: 267 CFHNRVIRIDF-QGGARYPIRPIVSRITIHWP----------VVLQRRDWENPGVTQLNR 413 C H++V++I+F Q G R + + + + VVLQRRDWENPGVTQLNR Sbjct: 37 CCHDKVVKIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNR 96 Query: 414 LAAHPPFASWRNSEEARTDRPSQQLR 491 LAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 97 LAAHPPFASWRNSEEARTDRPSQQLR 122 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 102 bits (245), Expect = 3e-22 Identities = 47/64 (73%), Positives = 51/64 (79%) Frame = +3 Query: 300 QGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 479 +GG P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 43 RGGIGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 102 Query: 480 QQLR 491 QQLR Sbjct: 103 QQLR 106 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 102 bits (245), Expect = 3e-22 Identities = 47/65 (72%), Positives = 51/65 (78%) Frame = +3 Query: 297 FQGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 476 F+ R P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP Sbjct: 52 FEAQKRDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 111 Query: 477 SQQLR 491 SQQLR Sbjct: 112 SQQLR 116 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 102 bits (245), Expect = 3e-22 Identities = 47/65 (72%), Positives = 51/65 (78%) Frame = +3 Query: 297 FQGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 476 + G +YP ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP Sbjct: 15 YLGYIKYPPESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 74 Query: 477 SQQLR 491 SQQLR Sbjct: 75 SQQLR 79 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 102 bits (245), Expect = 3e-22 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -1 Query: 505 FAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ 353 ++I+ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT + Sbjct: 460 YSIRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAR 510 >SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 102 bits (244), Expect = 4e-22 Identities = 48/64 (75%), Positives = 51/64 (79%) Frame = -1 Query: 490 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYR 311 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSR 59 Query: 310 APPW 299 PW Sbjct: 60 GSPW 63 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 101 bits (243), Expect = 5e-22 Identities = 51/73 (69%), Positives = 54/73 (73%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVI 341 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT + Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLA 74 Query: 340 RLTIGRIGYRAPP 302 L + G PP Sbjct: 75 CLQVDSRGSPFPP 87 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 101 bits (243), Expect = 5e-22 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -1 Query: 508 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 P+ + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 526 PYTQRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 575 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 101 bits (243), Expect = 5e-22 Identities = 51/75 (68%), Positives = 55/75 (73%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVI 341 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT + Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLA 74 Query: 340 RLTIGRIGYRAPPWK 296 L + G P+K Sbjct: 75 CLQVDSRGSPVAPFK 89 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 101 bits (243), Expect = 5e-22 Identities = 47/72 (65%), Positives = 52/72 (72%) Frame = +3 Query: 276 NRVIRIDFQGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 455 N + + G P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 693 NECLLVKIYQGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 752 Query: 456 EARTDRPSQQLR 491 EARTDRPSQQLR Sbjct: 753 EARTDRPSQQLR 764 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 101 bits (243), Expect = 5e-22 Identities = 48/66 (72%), Positives = 52/66 (78%) Frame = -1 Query: 556 NKNLTRILTKY*RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQS 377 NKN R ++ + + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQS Sbjct: 201 NKNSKRFQGNSQSSKYCISAKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQS 260 Query: 376 RRCKTT 359 RRCKTT Sbjct: 261 RRCKTT 266 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 101 bits (242), Expect = 7e-22 Identities = 51/77 (66%), Positives = 57/77 (74%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVI 341 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---A 71 Query: 340 RLTIGRIGYRAPPWKSI 290 +L ++ R P K++ Sbjct: 72 KLACLQVDSRGSPLKAV 88 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 101 bits (242), Expect = 7e-22 Identities = 47/52 (90%), Positives = 47/52 (90%) Frame = -1 Query: 514 QFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 Q PFAIQ WEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 9 QAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 60 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 101 bits (242), Expect = 7e-22 Identities = 47/63 (74%), Positives = 50/63 (79%) Frame = +3 Query: 303 GGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 482 G A P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ Sbjct: 38 GDAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 97 Query: 483 QLR 491 QLR Sbjct: 98 QLR 100 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 101 bits (242), Expect = 7e-22 Identities = 46/58 (79%), Positives = 49/58 (84%) Frame = -3 Query: 491 AQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 318 AQLLGRAIGAGLFAITPAGERGMCCK+IKL +A VFP + PVNCNTTHYRANW Sbjct: 4 AQLLGRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 101 bits (242), Expect = 7e-22 Identities = 47/52 (90%), Positives = 47/52 (90%) Frame = -1 Query: 514 QFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 Q PFAIQ WEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 9 QAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 60 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 101 bits (241), Expect = 9e-22 Identities = 49/69 (71%), Positives = 54/69 (78%) Frame = -1 Query: 490 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYR 311 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSR 59 Query: 310 APPWKSILI 284 P KS ++ Sbjct: 60 GSPLKSQML 68 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 101 bits (241), Expect = 9e-22 Identities = 48/69 (69%), Positives = 53/69 (76%), Gaps = 1/69 (1%) Frame = +3 Query: 288 RIDFQG-GARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 464 R+D + G P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR Sbjct: 42 RLDVEAFGRGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 101 Query: 465 TDRPSQQLR 491 TDRPSQQLR Sbjct: 102 TDRPSQQLR 110 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 101 bits (241), Expect = 9e-22 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -1 Query: 508 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 P A + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 52 PQAPRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 101 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 101 bits (241), Expect = 9e-22 Identities = 48/61 (78%), Positives = 50/61 (81%) Frame = -3 Query: 503 RHSXAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTL*NDGPVNCNTTHYRA 324 R+ AQLLGR+IGAGLFAITPAGERGMCCKAIKLGNAR FP PVNCNTTHYRA Sbjct: 37 RYRVAQLLGRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRA 96 Query: 323 N 321 N Sbjct: 97 N 97 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 101 bits (241), Expect = 9e-22 Identities = 50/66 (75%), Positives = 52/66 (78%), Gaps = 4/66 (6%) Frame = +3 Query: 306 GARYPIRPIVSRITIHW----PVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR 473 G YP P SR + + VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR Sbjct: 42 GLNYPFVPKSSRHSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR 101 Query: 474 PSQQLR 491 PSQQLR Sbjct: 102 PSQQLR 107 >SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 101 bits (241), Expect = 9e-22 Identities = 49/75 (65%), Positives = 54/75 (72%) Frame = -1 Query: 490 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYR 311 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT + L + G Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 Query: 310 APPWKSILITRLWKH 266 P+ + R +H Sbjct: 63 FVPFDYVFCGRKLRH 77 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 100 bits (240), Expect = 1e-21 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -1 Query: 496 QXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 Q RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 933 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 100 bits (240), Expect = 1e-21 Identities = 48/67 (71%), Positives = 52/67 (77%) Frame = +3 Query: 291 IDFQGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 470 I +GG P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD Sbjct: 81 ISIRGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 138 Query: 471 RPSQQLR 491 RPSQQLR Sbjct: 139 RPSQQLR 145 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 100 bits (240), Expect = 1e-21 Identities = 49/69 (71%), Positives = 54/69 (78%) Frame = -1 Query: 490 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYR 311 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSR 59 Query: 310 APPWKSILI 284 P + +LI Sbjct: 60 GSPSRLLLI 68 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 100 bits (240), Expect = 1e-21 Identities = 46/60 (76%), Positives = 49/60 (81%) Frame = +3 Query: 312 RYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 R P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 94 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 153 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 100 bits (240), Expect = 1e-21 Identities = 46/68 (67%), Positives = 52/68 (76%) Frame = +3 Query: 288 RIDFQGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART 467 R++ + P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART Sbjct: 51 RVETREACGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART 110 Query: 468 DRPSQQLR 491 DRPSQQLR Sbjct: 111 DRPSQQLR 118 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 100 bits (240), Expect = 1e-21 Identities = 51/78 (65%), Positives = 56/78 (71%) Frame = -1 Query: 490 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYR 311 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSR 59 Query: 310 APPWKSILITRLWKH*GR 257 P++ I L GR Sbjct: 60 GSPYREAYIECLTGGEGR 77 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 100 bits (240), Expect = 1e-21 Identities = 45/52 (86%), Positives = 45/52 (86%) Frame = +3 Query: 336 SRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 SRITIHWP WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 53 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 100 bits (240), Expect = 1e-21 Identities = 50/70 (71%), Positives = 53/70 (75%) Frame = +3 Query: 282 VIRIDFQGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 461 V R D QG P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 41 VRRHDAQGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 97 Query: 462 RTDRPSQQLR 491 RTDRPSQQLR Sbjct: 98 RTDRPSQQLR 107 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 100 bits (240), Expect = 1e-21 Identities = 50/68 (73%), Positives = 53/68 (77%) Frame = -1 Query: 490 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYR 311 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSR 59 Query: 310 APPWKSIL 287 P KS L Sbjct: 60 GSPEKSPL 67 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 100 bits (240), Expect = 1e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = +3 Query: 333 VSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 +SRIT VVLQRRDWEN GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 88 LSRITNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 140 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 100 bits (240), Expect = 1e-21 Identities = 47/65 (72%), Positives = 50/65 (76%) Frame = +3 Query: 297 FQGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 476 FQ P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP Sbjct: 107 FQRDQGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 166 Query: 477 SQQLR 491 SQQLR Sbjct: 167 SQQLR 171 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 100 bits (240), Expect = 1e-21 Identities = 47/65 (72%), Positives = 50/65 (76%) Frame = +3 Query: 297 FQGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 476 F A P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP Sbjct: 70 FPNKAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 129 Query: 477 SQQLR 491 SQQLR Sbjct: 130 SQQLR 134 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 100 bits (240), Expect = 1e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -1 Query: 499 IQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 I+ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 239 IRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 285 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 100 bits (240), Expect = 1e-21 Identities = 48/70 (68%), Positives = 52/70 (74%) Frame = +3 Query: 282 VIRIDFQGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 461 V R F + P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 83 VSRSSFGMASGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 142 Query: 462 RTDRPSQQLR 491 RTDRPSQQLR Sbjct: 143 RTDRPSQQLR 152 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 100 bits (240), Expect = 1e-21 Identities = 47/66 (71%), Positives = 50/66 (75%) Frame = +3 Query: 294 DFQGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR 473 D G P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR Sbjct: 17 DVAGEEGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR 76 Query: 474 PSQQLR 491 PSQQLR Sbjct: 77 PSQQLR 82 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 100 bits (240), Expect = 1e-21 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -1 Query: 496 QXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 Q RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 164 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 209 Score = 99.1 bits (236), Expect = 4e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 360 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 51 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 100 bits (240), Expect = 1e-21 Identities = 52/79 (65%), Positives = 56/79 (70%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVI 341 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT + Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLA 74 Query: 340 RLTIGRIGYRAPPWKSILI 284 L + G P IL+ Sbjct: 75 CLQVDSRGSPKYPCTIILV 93 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 100 bits (240), Expect = 1e-21 Identities = 51/74 (68%), Positives = 55/74 (74%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVI 341 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT + Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLA 74 Query: 340 RLTIGRIGYRAPPW 299 L + G +P W Sbjct: 75 CLQVDSRG--SPTW 86 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 100 bits (240), Expect = 1e-21 Identities = 46/60 (76%), Positives = 49/60 (81%) Frame = +3 Query: 312 RYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 R P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 7 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 66 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 100 bits (240), Expect = 1e-21 Identities = 46/60 (76%), Positives = 49/60 (81%) Frame = +3 Query: 312 RYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 R P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 10 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 69 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 100 bits (240), Expect = 1e-21 Identities = 52/75 (69%), Positives = 55/75 (73%), Gaps = 1/75 (1%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVI 341 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT + Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLA 74 Query: 340 RLTIGRIGY-RAPPW 299 L + G R P W Sbjct: 75 CLQVDSRGSPRKPFW 89 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 100 bits (239), Expect = 2e-21 Identities = 47/64 (73%), Positives = 50/64 (78%) Frame = +3 Query: 300 QGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 479 Q A P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 14 QVSAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 73 Query: 480 QQLR 491 QQLR Sbjct: 74 QQLR 77 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 100 bits (239), Expect = 2e-21 Identities = 54/82 (65%), Positives = 58/82 (70%) Frame = -1 Query: 490 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYR 311 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSR 59 Query: 310 APPWKSILITRLWKH*GRNGSR 245 P K TR WK G N + Sbjct: 60 GSPSKH--RTR-WKRQGVNAGQ 78 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 100 bits (239), Expect = 2e-21 Identities = 46/62 (74%), Positives = 49/62 (79%) Frame = +3 Query: 306 GARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 485 G P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ Sbjct: 88 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 147 Query: 486 LR 491 LR Sbjct: 148 LR 149 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 100 bits (239), Expect = 2e-21 Identities = 47/68 (69%), Positives = 51/68 (75%) Frame = +3 Query: 288 RIDFQGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART 467 R+D P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART Sbjct: 33 RLDVVVAQGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART 92 Query: 468 DRPSQQLR 491 DRPSQQLR Sbjct: 93 DRPSQQLR 100 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 100 bits (239), Expect = 2e-21 Identities = 48/65 (73%), Positives = 51/65 (78%) Frame = +3 Query: 297 FQGGARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 476 FQG P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP Sbjct: 30 FQGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 86 Query: 477 SQQLR 491 SQQLR Sbjct: 87 SQQLR 91 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 100 bits (239), Expect = 2e-21 Identities = 52/84 (61%), Positives = 59/84 (70%) Frame = -1 Query: 490 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYR 311 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSR 59 Query: 310 APPWKSILITRLWKH*GRNGSRQE 239 P K+ + W+ G R+E Sbjct: 60 GSPEKACDV--YWEVLDEPGERKE 81 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 100 bits (239), Expect = 2e-21 Identities = 46/52 (88%), Positives = 47/52 (90%) Frame = +3 Query: 360 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRX*MANGNC 515 VVLQRRDWENPGVTQLNRLAAHPPFASWRN+EEARTDRPSQQLR NG C Sbjct: 42 VVLQRRDWENPGVTQLNRLAAHPPFASWRNNEEARTDRPSQQLR--SLNGEC 91 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 100 bits (239), Expect = 2e-21 Identities = 46/58 (79%), Positives = 51/58 (87%), Gaps = 3/58 (5%) Frame = +3 Query: 327 PIVSRITIHW---PVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P++ R+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 107 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 100 bits (239), Expect = 2e-21 Identities = 51/78 (65%), Positives = 57/78 (73%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVI 341 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---A 71 Query: 340 RLTIGRIGYRAPPWKSIL 287 +L ++ R P K+ + Sbjct: 72 KLACLQVDSRGSPSKATI 89 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 100 bits (239), Expect = 2e-21 Identities = 50/71 (70%), Positives = 54/71 (76%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVI 341 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT + Sbjct: 260 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLA 317 Query: 340 RLTIGRIGYRA 308 L + G R+ Sbjct: 318 CLQVDSRGSRS 328 >SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 100 bits (239), Expect = 2e-21 Identities = 48/65 (73%), Positives = 52/65 (80%) Frame = -1 Query: 490 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYR 311 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSR 59 Query: 310 APPWK 296 P+K Sbjct: 60 GSPFK 64 >SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 100 bits (239), Expect = 2e-21 Identities = 48/69 (69%), Positives = 53/69 (76%) Frame = -1 Query: 490 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYR 311 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSR 59 Query: 310 APPWKSILI 284 P K + + Sbjct: 60 GSPVKVVFV 68 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 470 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 521 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 107 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 70 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 73 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 17 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 63 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 821 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 878 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 102 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 159 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 65 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 64 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 133 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 120 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 177 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 67 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 141 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 198 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 66 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 99 bits (238), Expect = 2e-21 Identities = 46/62 (74%), Positives = 49/62 (79%) Frame = +3 Query: 306 GARYPIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 485 G P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ Sbjct: 31 GVGDPLESSCRHASLALDVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 90 Query: 486 LR 491 LR Sbjct: 91 LR 92 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 644 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 695 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 105 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 78 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 93 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 63 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 120 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 67 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 88 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 145 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 118 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 73 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 191 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 104 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 133 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 1178 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 1235 Score = 69.3 bits (162), Expect = 3e-12 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 508 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSW 401 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSW Sbjct: 406 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSW 439 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 113 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 170 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 65 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 122 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 76 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 84 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 141 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 49 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 106 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 129 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 129 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 129 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 66 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 69 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 69 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 64 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 121 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 553 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 604 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 55 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 112 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 79 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 136 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 86 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 1051 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 1108 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 99 bits (238), Expect = 2e-21 Identities = 47/67 (70%), Positives = 54/67 (80%) Frame = -1 Query: 490 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIGRIGYR 311 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSR 59 Query: 310 APPWKSI 290 P++++ Sbjct: 60 GSPYENM 66 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 62 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 76 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 99 bits (238), Expect = 2e-21 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = -1 Query: 508 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ 353 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT + Sbjct: 181 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAK 230 Score = 95.9 bits (228), Expect = 4e-20 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +3 Query: 360 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 VVLQRRDWEN GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 517 VVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 560 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 122 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 179 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 170 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 227 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 158 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 215 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 104 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 64 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 191 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 104 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 161 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 99 bits (238), Expect = 2e-21 Identities = 46/55 (83%), Positives = 48/55 (87%) Frame = -1 Query: 490 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIRLTIG 326 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT + L +G Sbjct: 452 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVG 506 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 11 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 68 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 640 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 697 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 149 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 206 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 92 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 77 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 67 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 115 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 62 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 105 Score = 58.0 bits (134), Expect = 9e-09 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +3 Query: 411 RLAAHPPFASWRNSEEARTDRPSQQLR 491 +++AHPPFASWRNSEEARTDRPSQQLR Sbjct: 14 QVSAHPPFASWRNSEEARTDRPSQQLR 40 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 59 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 116 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 124 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 173 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 230 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 118 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 254 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 311 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 65 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 115 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 92 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 149 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 108 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 118 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 62 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 62 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 119 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 128 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 164 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 221 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 76 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 128 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 65 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 118 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 130 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 187 >SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 73 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 56 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 113 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 114 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 65 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 99 bits (238), Expect = 2e-21 Identities = 48/65 (73%), Positives = 54/65 (83%) Frame = -1 Query: 508 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQ*IVIRLTI 329 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L++ Sbjct: 34 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLSV 88 Query: 328 GRIGY 314 ++ Y Sbjct: 89 MQVDY 93 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 89 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 107 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 126 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 179 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 236 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 75 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 132 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 38 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 86 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 67 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 65 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 171 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 114 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 63 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 42 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 133 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 65 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 82 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 139 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 155 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 212 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 99 bits (238), Expect = 2e-21 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -1 Query: 499 IQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 ++ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 53 LRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 99 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 87 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 62 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 78 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 124 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 93 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 150 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 107 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 164 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 140 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 197 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 90 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 147 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 71 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 100 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 101 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 144 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 114 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 63 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 71 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 130 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 89 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 138 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 127 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 184 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 99 bits (238), Expect = 2e-21 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 318 PIRPIVSRITIHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 491 P+ ++ VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 133 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 190 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 17 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 68 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 99 bits (238), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = -1 Query: 520 RLQFPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 359 R PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 9 RRHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,788,643 Number of Sequences: 59808 Number of extensions: 542602 Number of successful extensions: 5189 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5146 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2299585728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -