BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0229.Seq (901 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-887|AAZ66448.1| 9606|Drosophila melanogaster CG33715-PE... 29 8.7 >AE014134-887|AAZ66448.1| 9606|Drosophila melanogaster CG33715-PE, isoform E protein. Length = 9606 Score = 29.1 bits (62), Expect = 8.7 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 128 ATSETTWASTHRRPAPRWSTATSHAKSTPXTYI 226 +TSE TW++ +RP WS +T + K T T + Sbjct: 3769 STSELTWSALVQRPG-EWSDSTVNKKQTSHTAV 3800 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,165,123 Number of Sequences: 53049 Number of extensions: 801318 Number of successful extensions: 1622 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1622 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4382549442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -