BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0226.Seq (742 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1692 - 28733184-28733980,28734306-28734373,28734481-287345... 28 6.8 01_05_0005 - 16886553-16886946,16887079-16887404 28 9.0 >07_03_1692 - 28733184-28733980,28734306-28734373,28734481-28734594, 28734835-28734884,28735012-28735422,28735534-28735610, 28736083-28736257,28736843-28736939,28737070-28737833, 28737900-28738001,28738093-28738174,28739004-28739161 Length = 964 Score = 28.3 bits (60), Expect = 6.8 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 6/47 (12%) Frame = +2 Query: 434 RYFSSLPPRAGSG*FARLLPSLDVVPFLRL---PLRNR---TLIPRY 556 R+F + PPR G G A P+ D++P LR+ P R L+PRY Sbjct: 295 RHFLTRPPRVGEG--AVFDPTKDMLPHLRVARPPAEGRGRNQLLPRY 339 >01_05_0005 - 16886553-16886946,16887079-16887404 Length = 239 Score = 27.9 bits (59), Expect = 9.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 298 RNNFSIRYWSWNYRGC 345 R+N S RYW W GC Sbjct: 90 RSNSSFRYWRWQPHGC 105 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,787,256 Number of Sequences: 37544 Number of extensions: 412535 Number of successful extensions: 931 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 929 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -