BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0221.Seq (907 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 76 3e-14 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 6e-14 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 71 1e-12 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 69 5e-12 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 69 5e-12 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 69 5e-12 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 69 5e-12 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 69 5e-12 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 69 5e-12 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 69 5e-12 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 69 5e-12 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 69 5e-12 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 69 5e-12 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 69 5e-12 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 69 5e-12 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 69 5e-12 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 69 5e-12 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 66 4e-11 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 66 5e-11 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 66 5e-11 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 66 5e-11 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 65 6e-11 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 65 6e-11 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 65 6e-11 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 65 6e-11 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 65 6e-11 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 65 6e-11 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 65 6e-11 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 65 6e-11 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 65 6e-11 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 65 6e-11 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 65 6e-11 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 65 6e-11 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 65 6e-11 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 65 6e-11 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 65 6e-11 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 65 6e-11 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 65 6e-11 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 65 6e-11 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 65 6e-11 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 65 6e-11 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 65 6e-11 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 65 6e-11 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 65 6e-11 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 65 6e-11 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 65 6e-11 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 65 6e-11 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 65 6e-11 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 65 6e-11 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 65 6e-11 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 65 6e-11 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 65 6e-11 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 65 6e-11 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 65 6e-11 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 65 6e-11 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 65 6e-11 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 65 6e-11 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 65 6e-11 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 65 6e-11 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 65 6e-11 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 65 6e-11 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 65 6e-11 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 65 6e-11 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 65 6e-11 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 65 6e-11 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 65 6e-11 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 65 6e-11 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 65 6e-11 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 65 6e-11 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 65 6e-11 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 65 6e-11 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 65 6e-11 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 65 6e-11 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 65 6e-11 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 65 6e-11 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 65 6e-11 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 65 6e-11 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 65 6e-11 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 65 6e-11 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 65 6e-11 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 65 6e-11 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 65 6e-11 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 65 6e-11 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 65 6e-11 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 65 6e-11 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 65 6e-11 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 65 6e-11 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 65 6e-11 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 65 6e-11 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 65 8e-11 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 64 1e-10 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 64 1e-10 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 64 1e-10 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 64 1e-10 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 64 2e-10 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 64 2e-10 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 64 2e-10 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 64 2e-10 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 64 2e-10 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 64 2e-10 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 64 2e-10 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 64 2e-10 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 64 2e-10 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 64 2e-10 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 64 2e-10 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 64 2e-10 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 64 2e-10 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 64 2e-10 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 64 2e-10 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 64 2e-10 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 64 2e-10 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 84.6 bits (200), Expect = 1e-16 Identities = 45/70 (64%), Positives = 51/70 (72%), Gaps = 3/70 (4%) Frame = +1 Query: 634 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLFASWVI-RRGPXDXPSQKVAPL- 807 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQHIPL + VI D PSQ++ L Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLN 92 Query: 808 -KWRMANCKG 834 +W A C G Sbjct: 93 GEWD-APCSG 101 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 84.2 bits (199), Expect = 1e-16 Identities = 43/63 (68%), Positives = 45/63 (71%), Gaps = 2/63 (3%) Frame = -2 Query: 813 PFXGRNFLGRXI-VRXSSYYPACEKGDVLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYR 640 P LGR I + PA EKGDVLQGD +G RQGFPSHDVVKRRPVNCNTTHYR Sbjct: 40 PSQAAQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYR 99 Query: 639 ANW 631 ANW Sbjct: 100 ANW 102 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 83.0 bits (196), Expect = 3e-16 Identities = 44/65 (67%), Positives = 47/65 (72%), Gaps = 3/65 (4%) Frame = +1 Query: 649 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLFASW-VIRRGPXDXPSQKVAPL--KWRM 819 SRITIHWPSFYNVVTGKTLALPNLIALQHIP FASW D PSQ++ L +W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSLNGEWD- 60 Query: 820 ANCKG 834 A C G Sbjct: 61 APCSG 65 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 80.2 bits (189), Expect = 2e-15 Identities = 43/68 (63%), Positives = 49/68 (72%), Gaps = 3/68 (4%) Frame = +1 Query: 640 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLFASWVIR-RGPXDXPSQKVAPL--K 810 P +SRITIHWPSFYNVVTGKTLALPNLIALQHIPL + + R D PSQ++ L + Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGE 136 Query: 811 WRMANCKG 834 W A C G Sbjct: 137 WD-APCSG 143 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 77.0 bits (181), Expect = 2e-14 Identities = 42/65 (64%), Positives = 46/65 (70%), Gaps = 3/65 (4%) Frame = +1 Query: 649 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLFASWV-IRRGPXDXPSQKVAPL--KWRM 819 SRITIHWPSFYNVVTGKTLALPNLIALQHIPL + V D PSQ++ L +W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEWD- 60 Query: 820 ANCKG 834 A C G Sbjct: 61 APCSG 65 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 76.2 bits (179), Expect = 3e-14 Identities = 42/65 (64%), Positives = 45/65 (69%), Gaps = 3/65 (4%) Frame = +1 Query: 649 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLFASW-VIRRGPXDXPSQKVAPL--KWRM 819 SRITIHWPSFYNVVTGKTLALPNLIALQ P FASW D PSQ++ L +W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEWD- 60 Query: 820 ANCKG 834 A C G Sbjct: 61 APCSG 65 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 76.2 bits (179), Expect = 3e-14 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +1 Query: 649 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLFASWVIRRGP 774 SRITIHWPSFYNVVTGKTLALPNLIALQHIPL + VI + P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 43 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 75.4 bits (177), Expect = 6e-14 Identities = 40/65 (61%), Positives = 45/65 (69%), Gaps = 3/65 (4%) Frame = +1 Query: 649 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLFASWVI-RRGPXDXPSQKVAPL--KWRM 819 SRITIHWPSFYNVVTGKTLALPNL L+HIPL+AS D PSQ++ L +W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNGEWD- 60 Query: 820 ANCKG 834 A C G Sbjct: 61 APCSG 65 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 74.1 bits (174), Expect = 1e-13 Identities = 36/55 (65%), Positives = 40/55 (72%) Frame = -1 Query: 829 YNLPFAIXGAQLFGKXNRXXLFVLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 + PFAI AQL+ + +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 74.1 bits (174), Expect = 1e-13 Identities = 36/55 (65%), Positives = 40/55 (72%) Frame = -1 Query: 829 YNLPFAIXGAQLFGKXNRXXLFVLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 + PFAI AQL+ + +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 73.7 bits (173), Expect = 2e-13 Identities = 41/65 (63%), Positives = 44/65 (67%), Gaps = 3/65 (4%) Frame = +1 Query: 649 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLFASW-VIRRGPXDXPSQKVAPL--KWRM 819 SRITIHWPSFYNVVTGKTLALPNLIAL P FASW D PSQ++ L +W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSLNGEWD- 60 Query: 820 ANCKG 834 A C G Sbjct: 61 APCSG 65 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 73.7 bits (173), Expect = 2e-13 Identities = 36/55 (65%), Positives = 39/55 (70%) Frame = -1 Query: 829 YNLPFAIXGAQLFGKXNRXXLFVLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 + PFAI AQL + +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLLEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 71.3 bits (167), Expect = 1e-12 Identities = 43/78 (55%), Positives = 48/78 (61%), Gaps = 3/78 (3%) Frame = +1 Query: 610 TRGGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLFASW-VIRRGPXDXP 786 T GGA PIRPIVSRITIHWP+FYN TGKTLA L L P FASW + D P Sbjct: 34 TDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRP 91 Query: 787 SQKVAPL--KWRMANCKG 834 SQ++ L +W A C G Sbjct: 92 SQQLRSLNGEWD-APCSG 108 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 70.1 bits (164), Expect = 2e-12 Identities = 33/45 (73%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = +1 Query: 664 HWPSFYNVVTGKTLALPNLIALQHIPLFASW-VIRRGPXDXPSQK 795 HWPSFYN VTGKTLALPNLIALQHIP FASW + D PSQ+ Sbjct: 5 HWPSFYNDVTGKTLALPNLIALQHIPTFASWRNSQEARTDRPSQQ 49 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 69.3 bits (162), Expect = 4e-12 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -1 Query: 802 AQLFGKXNRXXLFVLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 AQL+ + +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 AQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 69.3 bits (162), Expect = 4e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 754 SLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 S RKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 79 SWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 235 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 903 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 390 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 239 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 306 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 372 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 64 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 46 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 282 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 266 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 255 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 280 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 464 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 133 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 299 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 149 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 9 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 208 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 600 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 236 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 514 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 97 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 405 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 9 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 198 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 68.1 bits (159), Expect = 9e-12 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL*YDSL 644 +L L KGGCAARRLSWVTPGFSQSRRCKTTASE D L Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 63.7 bits (148), Expect = 2e-10 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 666 LAVVLQRRDWENPGVTQLNRLAAHPPFRKLGNTK 767 LAVVLQRRDWENPGVTQLNRLAAHPPF N++ Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 118 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 68.1 bits (159), Expect = 9e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 +L L KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 342 LLRQLVKGGCAARRLSWVTPGFSQSRRCKTTASEL 376 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/55 (63%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = +1 Query: 664 HWPSFYNVVTGKTLALPNLIALQHIPLF-ASWVIRRGPXDXPSQKVAPL--KWRM 819 HWPSFYNVVTGKTLALPNLIALQHIPL A D PSQ++ L +WR+ Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNGEWRL 59 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 666 LAVVLQRRDWENPGVTQLNRLAAHPPFRKLGNTKR 770 LAVVLQRRDWENPGVTQLNRLAAHPPF GN+++ Sbjct: 131 LAVVLQRRDWENPGVTQLNRLAAHPPFASWGNSEK 165 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 67.3 bits (157), Expect = 2e-11 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASE 662 +L L KGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 545 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 67.3 bits (157), Expect = 2e-11 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +1 Query: 664 HWPSFYNVVTGKTLALPNLIALQHIPLFASWVIRRGP 774 HWPSFYNVVTGKTLALPNLIALQHIPL + VI + P Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 98 >SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 67.3 bits (157), Expect = 2e-11 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 666 LAVVLQRRDWENPGVTQLNRLAAHPPFRKLGNTKR 770 LAVVLQRRDWENPGVTQLNRLAAHPPF GN ++ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWGNNEK 63 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 67.3 bits (157), Expect = 2e-11 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +1 Query: 664 HWPSFYNVVTGKTLALPNLIALQHIPLFASWVIRRGP 774 HWPSFYNVVTGKTLALPNLIALQHIPL + VI + P Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 93 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 66.9 bits (156), Expect = 2e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 666 LAVVLQRRDWENPGVTQLNRLAAHPPFRKLGNTK 767 LAVVLQRRDWENPGVTQLNRLAAHPPF GN++ Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWGNSE 100 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 66.9 bits (156), Expect = 2e-11 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -2 Query: 756 PACEKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 631 PA E+G + +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 18 PAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/36 (58%), Positives = 24/36 (66%) Frame = -3 Query: 800 ATFWEGQSXGPLRITQLAKRGMCCKAIKLGNARVFP 693 AT +G G IT +RGMCCKAIKLGNA+ FP Sbjct: 3 ATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFP 38 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 66.9 bits (156), Expect = 2e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 666 LAVVLQRRDWENPGVTQLNRLAAHPPFRKLGNTK 767 LAVVLQRRDWENPGVTQLNRLAAHPPF GN++ Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFTSWGNSE 85 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 66.1 bits (154), Expect = 4e-11 Identities = 30/48 (62%), Positives = 32/48 (66%) Frame = +3 Query: 678 LQRRDWENPGVTQLNRLAAHPPFRKLGNTKRXXRLXFPKSCAPXMANG 821 LQRRDWENPGVTQLNRLAAHPPF N++R R FP P G Sbjct: 348 LQRRDWENPGVTQLNRLAAHPPFASWRNSERPHRSPFPTVAQPEWRMG 395 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 65.7 bits (153), Expect = 5e-11 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = -1 Query: 802 AQLFGKXNRXXLFVLPSLRKGGCAARRLSWVTPGFSQSRRCKTTASEL 659 AQL+ + +L L KGGCAARRLSWVTP FSQSRRCKTTASEL Sbjct: 2 AQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPVFSQSRRCKTTASEL 49 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 65.7 bits (153), Expect = 5e-11 Identities = 36/63 (57%), Positives = 36/63 (57%) Frame = -2 Query: 819 HSPFXGRNFLGRXIVRXSSYYPACEKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 640 HSPF RN VR SS KG GFPSHDVVKRRPVNCNTTHYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 645 Query: 639 ANW 631 ANW Sbjct: 646 ANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 65.7 bits (153), Expect = 5e-11 Identities = 36/63 (57%), Positives = 36/63 (57%) Frame = -2 Query: 819 HSPFXGRNFLGRXIVRXSSYYPACEKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 640 HSPF RN VR SS KG GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 88 Query: 639 ANW 631 ANW Sbjct: 89 ANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 65.7 bits (153), Expect = 5e-11 Identities = 36/63 (57%), Positives = 36/63 (57%) Frame = -2 Query: 819 HSPFXGRNFLGRXIVRXSSYYPACEKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 640 HSPF RN VR SS KG GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 88 Query: 639 ANW 631 ANW Sbjct: 89 ANW 91 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 491 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 161 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 193 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 238 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 270 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 382 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 84 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 665 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 574 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 421 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 453 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 48 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 80 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 804 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 836 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 465 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 497 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 84 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 386 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 418 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 1120 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 1152 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 311 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 343 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 125 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 157 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 9 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 51 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 83 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 501 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 533 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 109 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 141 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 69 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 101 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 71 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 103 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 65 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 97 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 170 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 202 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 207 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 239 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 143 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 175 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 114 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 146 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 70 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 102 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 9 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 9 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41 >SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +3 Query: 666 LAVVLQRRDWENPGVTQLNRLAAHPPFRKLGNTK 767 LAVVLQRRDWENPGVTQLNRLAAHPPF NT+ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNTE 92 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) Length = 229 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 65.3 bits (152), Expect = 6e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 763 VLPSLRKGGCAARRLSWVTPGFSQSRRCKTTAS 665 +L L KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 127 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 159 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,979,796 Number of Sequences: 59808 Number of extensions: 394737 Number of successful extensions: 4144 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4122 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2609867019 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -