Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0219.Seq
         (930 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q25804 Cluster: Rps4 protein; n=2; Plasmodium|Rep: Rps4...    35   2.6  

>UniRef50_Q25804 Cluster: Rps4 protein; n=2; Plasmodium|Rep: Rps4
           protein - Plasmodium falciparum
          Length = 208

 Score = 35.1 bits (77), Expect = 2.6
 Identities = 19/72 (26%), Positives = 36/72 (50%)
 Frame = -2

Query: 800 NQII*HGRSPRWIFTSXLLKR*FIKFYVTFLLNYNYIFTYSHIKFGVIIVHNNYCCITQL 621
           N I+      ++I    L+ +  I  Y++ L  YN+I  YS+ K+ +I ++N    I  +
Sbjct: 132 NDILFFNNKIKYIILKNLIYKYNIYIYISNLYKYNFIKIYSYNKYFIICIYNFKIKILNI 191

Query: 620 HNFFTKKISFVY 585
           +N     I ++Y
Sbjct: 192 NNIL-NNILYIY 202


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 897,294,749
Number of Sequences: 1657284
Number of extensions: 17606264
Number of successful extensions: 32547
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 31343
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32532
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 85670899699
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)