BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0210.Seq (895 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q17L42 Cluster: Putative uncharacterized protein; n=1; ... 34 5.6 >UniRef50_Q17L42 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 1214 Score = 33.9 bits (74), Expect = 5.6 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = -3 Query: 782 PQWATRYRLQPXQPANXV*NAVPSISKI*SNIYSTNYXISHTVPYSRSS 636 P T R+ P Q AN V +P + + S+ +STN+ HT+P + SS Sbjct: 702 PSSTTTPRVVPVQKANSV-TIIPHSTPLESHHHSTNFVADHTIPRTASS 749 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 695,669,809 Number of Sequences: 1657284 Number of extensions: 11900313 Number of successful extensions: 22981 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 22352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22981 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 80751996367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -