BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0208.Seq (887 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 103 3e-22 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 103 3e-22 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 103 3e-22 SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 3e-14 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) 67 2e-11 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 65 6e-11 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_45174| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50538| Best HMM Match : Moricin (HMM E-Value=4.5) 64 1e-10 SB_6719| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_51757| Best HMM Match : Hormone_recep (HMM E-Value=6.4e-37) 63 3e-10 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37193| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 62 4e-10 SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) 62 4e-10 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 62 6e-10 SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) 62 6e-10 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 62 6e-10 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 62 6e-10 SB_56401| Best HMM Match : Moricin (HMM E-Value=5.8) 62 8e-10 SB_43571| Best HMM Match : Ank (HMM E-Value=3e-34) 62 8e-10 SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) 62 8e-10 SB_39465| Best HMM Match : PDH (HMM E-Value=1.5) 62 8e-10 SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) 62 8e-10 SB_31282| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_26951| Best HMM Match : CUB (HMM E-Value=0) 62 8e-10 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 62 8e-10 SB_22630| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_56291| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) 62 8e-10 SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_48121| Best HMM Match : Kelch_1 (HMM E-Value=0.023) 62 8e-10 SB_39908| Best HMM Match : Prismane (HMM E-Value=3) 62 8e-10 SB_37382| Best HMM Match : Pkinase (HMM E-Value=1e-04) 62 8e-10 SB_35241| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 62 8e-10 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 62 8e-10 SB_17450| Best HMM Match : RVT_1 (HMM E-Value=2.2e-25) 62 8e-10 SB_3376| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) 61 1e-09 SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) 60 2e-09 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 60 2e-09 SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31) 60 2e-09 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 60 2e-09 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_41709| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_42228| Best HMM Match : Moricin (HMM E-Value=6.6) 60 3e-09 SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_2571| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 5e-09 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 5e-09 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 5e-09 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 5e-09 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 5e-09 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 5e-09 SB_29747| Best HMM Match : Ank (HMM E-Value=0) 59 5e-09 SB_29088| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 5e-09 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_51573| Best HMM Match : UCR_TM (HMM E-Value=6.7) 58 7e-09 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 58 7e-09 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 58 1e-08 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 58 1e-08 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 58 1e-08 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 58 1e-08 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56677| Best HMM Match : p450 (HMM E-Value=1.1e-10) 58 1e-08 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 58 1e-08 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 58 1e-08 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 58 1e-08 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 58 1e-08 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 58 1e-08 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 58 1e-08 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 58 1e-08 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 58 1e-08 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 58 1e-08 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 58 1e-08 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 58 1e-08 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 58 1e-08 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 58 1e-08 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 58 1e-08 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 58 1e-08 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 58 1e-08 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 58 1e-08 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 58 1e-08 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 58 1e-08 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 58 1e-08 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 58 1e-08 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 58 1e-08 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 58 1e-08 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 58 1e-08 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 58 1e-08 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 58 1e-08 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 58 1e-08 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 58 1e-08 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 58 1e-08 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 58 1e-08 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 58 1e-08 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 58 1e-08 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 58 1e-08 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 58 1e-08 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 58 1e-08 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 58 1e-08 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 58 1e-08 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 58 1e-08 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 58 1e-08 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 58 1e-08 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 58 1e-08 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 58 1e-08 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 58 1e-08 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 58 1e-08 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 58 1e-08 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 58 1e-08 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35870| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 58 1e-08 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 58 1e-08 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 58 1e-08 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 58 1e-08 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 58 1e-08 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 58 1e-08 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 58 1e-08 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 58 1e-08 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 58 1e-08 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 107 bits (256), Expect = 2e-23 Identities = 49/59 (83%), Positives = 49/59 (83%) Frame = -2 Query: 337 QXRNCWEGRSVRASSLLXQLAKGGCAASD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 161 Q RNCWEGRSVRASSLL QLAKGGCAA GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 103 bits (246), Expect = 3e-22 Identities = 51/67 (76%), Positives = 53/67 (79%) Frame = -2 Query: 361 AYNLPFAIQXRNCWEGRSVRASSLLXQLAKGGCAASD*VG*RQGFPSHDVVKRRPVNCNT 182 A + PF + RNCWEGRSVRASSLL QLAKGGCAA GFPSHDVVKRRPVNCNT Sbjct: 587 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNT 641 Query: 181 THYRANW 161 THYRANW Sbjct: 642 THYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 103 bits (246), Expect = 3e-22 Identities = 51/67 (76%), Positives = 53/67 (79%) Frame = -2 Query: 361 AYNLPFAIQXRNCWEGRSVRASSLLXQLAKGGCAASD*VG*RQGFPSHDVVKRRPVNCNT 182 A + PF + RNCWEGRSVRASSLL QLAKGGCAA GFPSHDVVKRRPVNCNT Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNT 84 Query: 181 THYRANW 161 THYRANW Sbjct: 85 THYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 103 bits (246), Expect = 3e-22 Identities = 51/67 (76%), Positives = 53/67 (79%) Frame = -2 Query: 361 AYNLPFAIQXRNCWEGRSVRASSLLXQLAKGGCAASD*VG*RQGFPSHDVVKRRPVNCNT 182 A + PF + RNCWEGRSVRASSLL QLAKGGCAA GFPSHDVVKRRPVNCNT Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNT 84 Query: 181 THYRANW 161 THYRANW Sbjct: 85 THYRANW 91 >SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 76.6 bits (180), Expect = 3e-14 Identities = 38/56 (67%), Positives = 39/56 (69%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWVTPGFSQSRRCKTTAS 195 RLQ A LLGRAIGAGLF ITPA ERGMC +RLSWV P FSQS RC AS Sbjct: 2 RLQAPFAIQAAHLLGRAIGAGLFDITPACERGMCARRLSWVMPAFSQSSRCIMAAS 57 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 73.7 bits (173), Expect = 2e-13 Identities = 39/52 (75%), Positives = 40/52 (76%) Frame = -2 Query: 349 PFAIQXRNCWEGRSVRASSLLXQLAKGGCAASD*VG*RQGFPSHDVVKRRPV 194 PF + RNCWEGRSVRASSLL QLAKGGCAA GFPSHDVVKRRPV Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAAR---RLSWGFPSHDVVKRRPV 67 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 68.5 bits (160), Expect = 7e-12 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWVTPGF 228 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + VTP F Sbjct: 1835 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVTPVF 1877 Score = 59.3 bits (137), Expect = 4e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 229 FPSHDVVKRRPVNCNTTHYRANW 161 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1877 FPSHDVVKRRPVNCNTTHYRANW 1899 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/63 (55%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = +2 Query: 164 IRPIVSRITIHWPSFYNVVTGKTLALPNLIACSTSPFRQLX**RRGPHRS-PFPTVAXLN 340 +RP+VSRITIHW SFYNVVTGKTLALPNLIA P P + LN Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLN 92 Query: 341 GEW 349 GEW Sbjct: 93 GEW 95 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 67.7 bits (158), Expect = 1e-11 Identities = 35/61 (57%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Frame = +2 Query: 170 PIVSRITIHWPSFYNVVTGKTLALPNLIACSTSPFRQLX**RRGPHRS-PFPTVAXLNGE 346 P +SRITIHWPSFYNVVTGKTLALPNLIA P R P + LNGE Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGE 136 Query: 347 W 349 W Sbjct: 137 W 137 >SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) Length = 1270 Score = 67.3 bits (157), Expect = 2e-11 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWVTPGFSQSRRCKTTA 198 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + TP ++R+ T+ Sbjct: 1121 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLDTPSSPRARKFGETS 1173 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 66.9 bits (156), Expect = 2e-11 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 247 VG*RQGFPSHDVVKRRPVNCNTTHYRANW 161 +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 74 LGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 332 AQLLGRAIGAGLFAITPAGERG 267 AQLLGRAIGAGLFAITPAGE+G Sbjct: 44 AQLLGRAIGAGLFAITPAGEKG 65 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 66.1 bits (154), Expect = 4e-11 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 2/66 (3%) Frame = -2 Query: 352 LPFAIQXRNCWEGRSVRASSLLXQLA--KGGCAASD*VG*RQGFPSHDVVKRRPVNCNTT 179 +PFAIQ GR++ A A +G C + +G FPSHDVVKRRPVNCNTT Sbjct: 3 VPFAIQAAQLL-GRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTT 61 Query: 178 HYRANW 161 HYRANW Sbjct: 62 HYRANW 67 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 65.7 bits (153), Expect = 5e-11 Identities = 34/58 (58%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Frame = +2 Query: 179 SRITIHWPSFYNVVTGKTLALPNLIACST-SPFRQLX**RRGPHRSPFPTVAXLNGEW 349 SRITIHWPSFYNVVTGKTLALPNLIA + PF P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 65.7 bits (153), Expect = 5e-11 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 274 KGGCAASD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 161 +G C + +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 RGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = -3 Query: 333 CATVGKGDRCGPLRYYXSWRKGDVLQAIKLGNARVFP 223 CATVGKGDRCG + +G +AIKLGNA+ FP Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFP 38 >SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1311 Score = 65.3 bits (152), Expect = 6e-11 Identities = 35/51 (68%), Positives = 39/51 (76%) Frame = -1 Query: 380 ILTKY*RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWVTPGF 228 IL R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + + PGF Sbjct: 104 ILRAQGRVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIK-LEPGF 151 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 65.3 bits (152), Expect = 6e-11 Identities = 34/58 (58%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Frame = +2 Query: 179 SRITIHWPSFYNVVTGKTLALPNLIACSTSPFRQLX**RRGPHRSPFP-TVAXLNGEW 349 SRITIHWPSFYNVVTGKTLALPNLIA P + P P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 64.9 bits (151), Expect = 8e-11 Identities = 34/58 (58%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +2 Query: 179 SRITIHWPSFYNVVTGKTLALPNLIACS-TSPFRQLX**RRGPHRSPFPTVAXLNGEW 349 SRITIHWPSFYNVVTGKTLALPNLIA PF P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 444 Score = 64.9 bits (151), Expect = 8e-11 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWVTP 234 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + V P Sbjct: 30 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVEP 70 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 64.9 bits (151), Expect = 8e-11 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -1 Query: 371 KY*RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 KY R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 3080 KYGRVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 3118 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 64.9 bits (151), Expect = 8e-11 Identities = 34/58 (58%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +2 Query: 179 SRITIHWPSFYNVVTGKTLALPNLIACST-SPFRQLX**RRGPHRSPFPTVAXLNGEW 349 SRITIHWPSFYNVVTGKTLALPNLIA PF P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEW 59 >SB_45174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 64.5 bits (150), Expect = 1e-10 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWVT 237 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + VT Sbjct: 75 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVT 114 >SB_50538| Best HMM Match : Moricin (HMM E-Value=4.5) Length = 173 Score = 64.5 bits (150), Expect = 1e-10 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWVT 237 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + VT Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVT 41 >SB_6719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 64.1 bits (149), Expect = 1e-10 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = -1 Query: 368 Y*RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWVTPGFSQSR 216 Y R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + V + +R Sbjct: 179 YGRVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVQIDHTSNR 227 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 63.7 bits (148), Expect = 2e-10 Identities = 32/46 (69%), Positives = 32/46 (69%) Frame = +3 Query: 195 TGRRFTTS*LGKPWRYPT*SLAAHPPFASWXNSEEARTDRPSQQLR 332 TGRRFT P LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 63.7 bits (148), Expect = 2e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 238 RQGFPSHDVVKRRPVNCNTTHYRANW 161 R GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 63.3 bits (147), Expect = 3e-10 Identities = 34/55 (61%), Positives = 38/55 (69%) Frame = -1 Query: 353 FAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWVTPGFSQSRRCKTTASEL 189 FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + V F + K T E+ Sbjct: 12 FAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVITHFIECLCEKYTTGEM 64 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 62.9 bits (146), Expect = 3e-10 Identities = 36/76 (47%), Positives = 43/76 (56%), Gaps = 4/76 (5%) Frame = -2 Query: 232 GFPSHDVVKRRPVNCNTTHYRANWVPGPPSIEVKQEXXXXXXKRDS--EAPAE-ADATMD 62 GFPSHDVVKRRPVNCNTTHYRANW ++ E R+S + P A T D Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW--SSTAVAAALELVDPPGCRNSMPDRPRHAARPTHD 58 Query: 61 TS-ESPETAEQPADDS 17 T + P A +P D+ Sbjct: 59 TQPDRPRHAARPTHDT 74 >SB_51757| Best HMM Match : Hormone_recep (HMM E-Value=6.4e-37) Length = 405 Score = 62.9 bits (146), Expect = 3e-10 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWVT 237 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + V+ Sbjct: 94 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVS 133 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 377 LTKY*RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 L+ + R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 1939 LSVFGRVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 1979 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 62.5 bits (145), Expect = 4e-10 Identities = 33/58 (56%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +2 Query: 179 SRITIHWPSFYNVVTGKTLALPNLIACSTSPFRQLX**RRGPHRS-PFPTVAXLNGEW 349 SRITIHWPSFYNVVTGKTLALPNLIA P P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_37193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWV 240 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + V Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLV 40 >SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 62.5 bits (145), Expect = 4e-10 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = -3 Query: 372 KILTLTICHSPFXCATVGKGDRCGPLRYYXSWRKGDVLQ 256 K+ L + CATVGKGDRCGPLRYY SWRKGDVLQ Sbjct: 50 KLACLQVDSRGSPCATVGKGDRCGPLRYYASWRKGDVLQ 88 Score = 54.8 bits (126), Expect = 9e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -2 Query: 331 RNCWEGRSVRASSLLXQLAKGGCAA 257 RNCWEGRSVRASSLL QLAKGGCAA Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAA 27 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = -1 Query: 320 GRAIGAGLFAITPAGERGMCCKRLSWVTPGFSQSRRCKTTAS 195 GR++ A + + G +RLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) Length = 556 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWV 240 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + V Sbjct: 256 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLV 294 >SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) Length = 745 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWV 240 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + V Sbjct: 386 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLV 424 >SB_44915| Best HMM Match : VWA (HMM E-Value=0) Length = 541 Score = 62.1 bits (144), Expect = 6e-10 Identities = 35/56 (62%), Positives = 39/56 (69%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWVTPGFSQSRRCKTTAS 195 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + S S C+ AS Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLDVDECSSS-PCQNGAS 54 >SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) Length = 272 Score = 62.1 bits (144), Expect = 6e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 333 CATVGKGDRCGPLRYYXSWRKGDVLQ 256 CATVGKGDRCGPLRYY SWRKGDVLQ Sbjct: 245 CATVGKGDRCGPLRYYASWRKGDVLQ 270 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 62.1 bits (144), Expect = 6e-10 Identities = 35/69 (50%), Positives = 39/69 (56%), Gaps = 1/69 (1%) Frame = +2 Query: 146 GGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNLIACST-SPFRQLX**RRGPHRSPFP 322 GGA PIRPIVSRITIHWP+FYN TGKTLA L + PF + P Sbjct: 36 GGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRPSQ 93 Query: 323 TVAXLNGEW 349 + LNGEW Sbjct: 94 QLRSLNGEW 102 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 62.1 bits (144), Expect = 6e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 333 CATVGKGDRCGPLRYYXSWRKGDVLQ 256 CATVGKGDRCGPLRYY SWRKGDVLQ Sbjct: 2 CATVGKGDRCGPLRYYASWRKGDVLQ 27 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 254 RLSWVTPGFSQSRRCKTTASEL 189 RLSWVTPGFSQSRRCKTTASEL Sbjct: 29 RLSWVTPGFSQSRRCKTTASEL 50 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 62.1 bits (144), Expect = 6e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 333 CATVGKGDRCGPLRYYXSWRKGDVLQ 256 CATVGKGDRCGPLRYY SWRKGDVLQ Sbjct: 91 CATVGKGDRCGPLRYYASWRKGDVLQ 116 Score = 55.2 bits (127), Expect = 7e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 349 PFAIQXRNCWEGRSVRASSLLXQLAKGGCAA 257 PF + RNCWEGRSVRASSLL QLAKGGCAA Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAA 49 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = -1 Query: 320 GRAIGAGLFAITPAGERGMCCKRLSWVTPGFSQSRRCKTTAS 195 GR++ A + + G +RLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56401| Best HMM Match : Moricin (HMM E-Value=5.8) Length = 106 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 >SB_43571| Best HMM Match : Ank (HMM E-Value=3e-34) Length = 584 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 >SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) Length = 980 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 >SB_39465| Best HMM Match : PDH (HMM E-Value=1.5) Length = 369 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 >SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) Length = 340 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 >SB_31282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 61.7 bits (143), Expect = 8e-10 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = -3 Query: 348 HSPFXCATVGKGDRCGPLRYYXSWRKGDVLQ 256 HSPF GKGDRCGPLRYY SWRKGDVLQ Sbjct: 4 HSPFRLRNCGKGDRCGPLRYYASWRKGDVLQ 34 >SB_26951| Best HMM Match : CUB (HMM E-Value=0) Length = 794 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 118 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 153 >SB_22630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 61.7 bits (143), Expect = 8e-10 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = -3 Query: 348 HSPFXCATVGKGDRCGPLRYYXSWRKGDVLQ 256 HSPF GKGDRCGPLRYY SWRKGDVLQ Sbjct: 4 HSPFRLRNCGKGDRCGPLRYYASWRKGDVLQ 34 >SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 >SB_56291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 109 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 144 >SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) Length = 799 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 >SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 >SB_48121| Best HMM Match : Kelch_1 (HMM E-Value=0.023) Length = 1169 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 730 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 765 >SB_39908| Best HMM Match : Prismane (HMM E-Value=3) Length = 456 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 Score = 55.6 bits (128), Expect = 5e-08 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -2 Query: 361 AYNLPFAIQXRNCWEGRSVRASSLLXQLAKGGCAA 257 A + PF + RNCWEGRSVRASSLL QLAKGGCAA Sbjct: 319 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAA 351 >SB_37382| Best HMM Match : Pkinase (HMM E-Value=1e-04) Length = 177 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 >SB_35241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 61.7 bits (143), Expect = 8e-10 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = -3 Query: 348 HSPFXCATVGKGDRCGPLRYYXSWRKGDVLQ 256 HSPF GKGDRCGPLRYY SWRKGDVLQ Sbjct: 11 HSPFRLRNCGKGDRCGPLRYYASWRKGDVLQ 41 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 61.7 bits (143), Expect = 8e-10 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -2 Query: 274 KGGCAASD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 161 +G C + +G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 16 RGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 Score = 48.0 bits (109), Expect = 1e-05 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 314 AIGAGLFAITPAGERGMCCKRL 249 AIGAGLFAITPAGERGMCCK + Sbjct: 2 AIGAGLFAITPAGERGMCCKAI 23 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 61.7 bits (143), Expect = 8e-10 Identities = 34/53 (64%), Positives = 36/53 (67%) Frame = -1 Query: 353 FAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWVTPGFSQSRRCKTTAS 195 FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + KTTAS Sbjct: 12 FAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTFKTTAS 62 >SB_17450| Best HMM Match : RVT_1 (HMM E-Value=2.2e-25) Length = 472 Score = 61.7 bits (143), Expect = 8e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 362 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 >SB_3376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 61.7 bits (143), Expect = 8e-10 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = -3 Query: 348 HSPFXCATVGKGDRCGPLRYYXSWRKGDVLQ 256 HSPF GKGDRCGPLRYY SWRKGDVLQ Sbjct: 4 HSPFRLRNCGKGDRCGPLRYYASWRKGDVLQ 34 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 61.3 bits (142), Expect = 1e-09 Identities = 35/64 (54%), Positives = 38/64 (59%) Frame = -2 Query: 331 RNCWEGRSVRASSLLXQLAKGGCAASD*VG*RQGFPSHDVVKRRPVNCNTTHYRANWVPG 152 RNCWEGRSVRASSLL QLAKGGCAA GF KRRPV + H + + Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV--PSLHACRSTLED 60 Query: 151 PPSI 140 PP I Sbjct: 61 PPEI 64 >SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) Length = 108 Score = 60.9 bits (141), Expect = 1e-09 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -1 Query: 353 FAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWVT 237 FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + V+ Sbjct: 7 FAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVS 43 >SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) Length = 407 Score = 60.5 bits (140), Expect = 2e-09 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -1 Query: 353 FAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWV 240 FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + V Sbjct: 12 FAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLV 47 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 60.5 bits (140), Expect = 2e-09 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -2 Query: 274 KGGCAASD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 161 +G C S + FPSHDVVKRRPVNCNTTHYRANW Sbjct: 24 RGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 Score = 59.3 bits (137), Expect = 4e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 332 AQLLGRAIGAGLFAITPAGERGMCCKRL 249 AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 4 AQLLGRAIGAGLFAITPAGERGMCCKSI 31 >SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31) Length = 1283 Score = 60.1 bits (139), Expect = 2e-09 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = -1 Query: 353 FAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRLSWVTP 234 FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + P Sbjct: 12 FAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLDLP 49 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 60.1 bits (139), Expect = 2e-09 Identities = 31/46 (67%), Positives = 31/46 (67%) Frame = -2 Query: 331 RNCWEGRSVRASSLLXQLAKGGCAASD*VG*RQGFPSHDVVKRRPV 194 RNCWEGRSVRASSLL QLAKGGCAA GF KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 60.1 bits (139), Expect = 2e-09 Identities = 31/46 (67%), Positives = 31/46 (67%) Frame = -2 Query: 331 RNCWEGRSVRASSLLXQLAKGGCAASD*VG*RQGFPSHDVVKRRPV 194 RNCWEGRSVRASSLL QLAKGGCAA GF KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 60.1 bits (139), Expect = 2e-09 Identities = 31/46 (67%), Positives = 31/46 (67%) Frame = -2 Query: 331 RNCWEGRSVRASSLLXQLAKGGCAASD*VG*RQGFPSHDVVKRRPV 194 RNCWEGRSVRASSLL QLAKGGCAA GF KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 60.1 bits (139), Expect = 2e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 344 RHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 R+ AQLLGR+IGAGLFAITPAGERGMCCK + Sbjct: 37 RYRVAQLLGRSIGAGLFAITPAGERGMCCKAI 68 Score = 57.2 bits (132), Expect = 2e-08 Identities = 29/53 (54%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Frame = -2 Query: 316 GRSVRASSLLXQLA--KGGCAASD*VG*RQGFPSHDVVKRRPVNCNTTHYRAN 164 GRS+ A A +G C + +G +GFPSHD KRRPVNCNTTHYRAN Sbjct: 45 GRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 60.1 bits (139), Expect = 2e-09 Identities = 31/46 (67%), Positives = 31/46 (67%) Frame = -2 Query: 331 RNCWEGRSVRASSLLXQLAKGGCAASD*VG*RQGFPSHDVVKRRPV 194 RNCWEGRSVRASSLL QLAKGGCAA GF KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 60.1 bits (139), Expect = 2e-09 Identities = 31/46 (67%), Positives = 31/46 (67%) Frame = -2 Query: 331 RNCWEGRSVRASSLLXQLAKGGCAASD*VG*RQGFPSHDVVKRRPV 194 RNCWEGRSVRASSLL QLAKGGCAA GF KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 60.1 bits (139), Expect = 2e-09 Identities = 31/46 (67%), Positives = 31/46 (67%) Frame = -2 Query: 331 RNCWEGRSVRASSLLXQLAKGGCAASD*VG*RQGFPSHDVVKRRPV 194 RNCWEGRSVRASSLL QLAKGGCAA GF KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_41709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 460 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 353 FAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 12 FAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 44 >SB_42228| Best HMM Match : Moricin (HMM E-Value=6.6) Length = 126 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 353 FAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKRL 249 FAI+ AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 12 FAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 44 >SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2806 Score = 59.3 bits (137), Expect = 4e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 332 AQLLGRAIGAGLFAITPAGERGMCCKRL 249 AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 2655 AQLLGRAIGAGLFAITPAGERGMCCKAI 2682 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 59.3 bits (137), Expect = 4e-09 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -2 Query: 373 QNINAYNLPFAIQXRNCWEGRSVRASSLLXQLAKGGCAA 257 ++++ + P+ + RNCWEGRSVRASSLL QLAKGGCAA Sbjct: 518 ESVSRNSTPYTQRLRNCWEGRSVRASSLLRQLAKGGCAA 556 Score = 52.8 bits (121), Expect = 4e-07 Identities = 25/43 (58%), Positives = 30/43 (69%) Frame = -1 Query: 320 GRAIGAGLFAITPAGERGMCCKRLSWVTPGFSQSRRCKTTASE 192 GR++ A + + G +RLSWVTPGFSQSRRCKTTASE Sbjct: 537 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 59.3 bits (137), Expect = 4e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 229 FPSHDVVKRRPVNCNTTHYRANW 161 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANW 59 >SB_2571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 59.3 bits (137), Expect = 4e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 332 AQLLGRAIGAGLFAITPAGERGMCCKRL 249 AQLLGRAIGAGLFAITPAGERGMCCK + Sbjct: 234 AQLLGRAIGAGLFAITPAGERGMCCKAI 261 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 58.8 bits (136), Expect = 5e-09 Identities = 30/46 (65%), Positives = 30/46 (65%) Frame = +3 Query: 195 TGRRFTTS*LGKPWRYPT*SLAAHPPFASWXNSEEARTDRPSQQLR 332 TGRR P LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 60 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 58.8 bits (136), Expect = 5e-09 Identities = 30/46 (65%), Positives = 30/46 (65%) Frame = +3 Query: 195 TGRRFTTS*LGKPWRYPT*SLAAHPPFASWXNSEEARTDRPSQQLR 332 TGRR P LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 58.8 bits (136), Expect = 5e-09 Identities = 30/46 (65%), Positives = 30/46 (65%) Frame = +3 Query: 195 TGRRFTTS*LGKPWRYPT*SLAAHPPFASWXNSEEARTDRPSQQLR 332 TGRR P LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 70 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 58.8 bits (136), Expect = 5e-09 Identities = 30/46 (65%), Positives = 30/46 (65%) Frame = +3 Query: 195 TGRRFTTS*LGKPWRYPT*SLAAHPPFASWXNSEEARTDRPSQQLR 332 TGRR P LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 58.8 bits (136), Expect = 5e-09 Identities = 30/46 (65%), Positives = 30/46 (65%) Frame = +3 Query: 195 TGRRFTTS*LGKPWRYPT*SLAAHPPFASWXNSEEARTDRPSQQLR 332 TGRR P LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 117 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 58.8 bits (136), Expect = 5e-09 Identities = 31/58 (53%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +2 Query: 179 SRITIHWPSFYNVVTGKTLALPNLIACSTSP-FRQLX**RRGPHRSPFPTVAXLNGEW 349 SRITIHWPSFYNVVTGKTLALPNL P + P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNGEW 59 >SB_29747| Best HMM Match : Ank (HMM E-Value=0) Length = 416 Score = 58.8 bits (136), Expect = 5e-09 Identities = 36/70 (51%), Positives = 42/70 (60%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLRX*MANGKL*ALIFC*NSR*IFVKSAHFLTNRPKS 434 LAAHPPFASW NSEEARTDRPSQQLR NG+ A C + + +A + R Sbjct: 311 LAAHPPFASWRNSEEARTDRPSQQLR--SLNGEWDAP--CSGA----LSAAGVVVTRSNG 362 Query: 435 AKSLINQKNR 464 K L+N K R Sbjct: 363 GKGLLNTKER 372 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 291 LAVVLQRRDWENPGVTQLNRLAAHP 315 >SB_29088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 58.8 bits (136), Expect = 5e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 237 RYPT*SLAAHPPFASWXNSEEARTDRPSQQLR 332 R P S+ AHPPFASW NSEEARTDRPSQQLR Sbjct: 22 RAPLGSIVAHPPFASWRNSEEARTDRPSQQLR 53 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 58.4 bits (135), Expect = 7e-09 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 370 NINAYNLPFAIQXRNCWEGRSVRASSLLXQLAKGGCAA 257 N+ A + PF + RNCWEGRSVRASSLL QLAKGGCAA Sbjct: 440 NMGASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAA 475 Score = 54.4 bits (125), Expect = 1e-07 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = -1 Query: 320 GRAIGAGLFAITPAGERGMCCKRLSWVTPGFSQSRRCKTTASEL 189 GR++ A + + G +RLSWVTPGFSQSRRCKTTASEL Sbjct: 456 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_51573| Best HMM Match : UCR_TM (HMM E-Value=6.7) Length = 93 Score = 58.4 bits (135), Expect = 7e-09 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +3 Query: 228 KPWRYPT*SLAAHPPFASWXNSEEARTDRPSQQLR 332 +P P+ S AAHPPFASW NSEEARTDRPSQQLR Sbjct: 13 RPNPVPSPSDAAHPPFASWRNSEEARTDRPSQQLR 47 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 256 LQHIPLSPAGVIAKRPAPIALPNSCA 333 LQHIPLSPAGVIAKRPAPIALPNSCA Sbjct: 83 LQHIPLSPAGVIAKRPAPIALPNSCA 108 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +2 Query: 194 HWPSFYNVVTGKTLALPNLIACSTSP 271 HWPSFYNVVTGKTLALPNLIA P Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIP 87 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 355 NLPFAIQXRNCWEGRSVRASSLLXQLAKGGCAA 257 +L ++I+ RNCWEGRSVRASSLL QLAKGGCAA Sbjct: 457 SLFYSIRLRNCWEGRSVRASSLLRQLAKGGCAA 489 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = -1 Query: 320 GRAIGAGLFAITPAGERGMCCKRLSWVTPGFSQSRRCKTTA 198 GR++ A + + G +RLSWVTPGFSQSRRCKTTA Sbjct: 470 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 509 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 58.4 bits (135), Expect = 7e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 256 LQHIPLSPAGVIAKRPAPIALPNSCA 333 LQHIPLSPAGVIAKRPAPIALPNSCA Sbjct: 78 LQHIPLSPAGVIAKRPAPIALPNSCA 103 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +2 Query: 194 HWPSFYNVVTGKTLALPNLIACSTSP 271 HWPSFYNVVTGKTLALPNLIA P Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIP 82 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 55 LAAHPPFASWRNSEEARTDRPSQQLR 80 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHP 59 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 82 LAAHPPFASWRNSEEARTDRPSQQLR 107 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 64 LAAHPPFASWRNSEEARTDRPSQQLR 89 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 56 LAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 82 LAAHPPFASWRNSEEARTDRPSQQLR 107 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 62 LAAHPPFASWRNSEEARTDRPSQQLR 87 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWEN GVTQLNRL P Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHP 66 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 87 LAAHPPFASWRNSEEARTDRPSQQLR 112 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 58 LAAHPPFASWRNSEEARTDRPSQQLR 83 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 78 LAAHPPFASWRNSEEARTDRPSQQLR 103 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 90 LAAHPPFASWRNSEEARTDRPSQQLR 115 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 66 LAAHPPFASWRNSEEARTDRPSQQLR 91 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHP 70 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 55 LAAHPPFASWRNSEEARTDRPSQQLR 80 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHP 59 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 45 LAAHPPFASWRNSEEARTDRPSQQLR 70 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 70 LAAHPPFASWRNSEEARTDRPSQQLR 95 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 79 LAAHPPFASWRNSEEARTDRPSQQLR 104 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 73 LAAHPPFASWRNSEEARTDRPSQQLR 98 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHP 77 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 89 LAAHPPFASWRNSEEARTDRPSQQLR 114 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 77 LAAHPPFASWRNSEEARTDRPSQQLR 102 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 60 LAAHPPFASWRNSEEARTDRPSQQLR 85 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWEN GVTQLNRL P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 236 LAAHPPFASWRNSEEARTDRPSQQLR 261 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHP 240 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 131 LAAHPPFASWRNSEEARTDRPSQQLR 156 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHP 135 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 69 LAAHPPFASWRNSEEARTDRPSQQLR 94 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 48 LAAHPPFASWRNSEEARTDRPSQQLR 73 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 36 LAAHPPFASWRNSEEARTDRPSQQLR 61 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 67 LAAHPPFASWRNSEEARTDRPSQQLR 92 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHP 71 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 401 LAAHPPFASWRNSEEARTDRPSQQLR 426 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHP 405 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 82 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 127 LAAHPPFASWRNSEEARTDRPSQQLR 152 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHP 131 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 103 LAAHPPFASWRNSEEARTDRPSQQLR 128 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 59 LAAHPPFASWRNSEEARTDRPSQQLR 84 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 28 LAAHPPFASWRNSEEARTDRPSQQLR 53 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHP 32 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 38 LAAHPPFASWRNSEEARTDRPSQQLR 63 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 58 LAAHPPFASWRNSEEARTDRPSQQLR 83 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 123 LAAHPPFASWRNSEEARTDRPSQQLR 148 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHP 127 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 65 LAAHPPFASWRNSEEARTDRPSQQLR 90 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHP 69 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 360 LAAHPPFASWRNSEEARTDRPSQQLR 385 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHP 364 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 100 LAAHPPFASWRNSEEARTDRPSQQLR 125 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHP 104 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 70 LAAHPPFASWRNSEEARTDRPSQQLR 95 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 36 LAAHPPFASWRNSEEARTDRPSQQLR 61 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 79 LAAHPPFASWRNSEEARTDRPSQQLR 104 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 63 LAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 154 LAAHPPFASWRNSEEARTDRPSQQLR 179 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHP 158 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 83 LAAHPPFASWRNSEEARTDRPSQQLR 108 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 59 LAAHPPFASWRNSEEARTDRPSQQLR 84 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_56677| Best HMM Match : p450 (HMM E-Value=1.1e-10) Length = 606 Score = 57.6 bits (133), Expect = 1e-08 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -2 Query: 373 QNINAYNLPFAIQXRNCWEGRSVRASSLLXQLAKGGCAA 257 + NA N P + RNCWEGRSVRASSLL QLAKGGCAA Sbjct: 375 ERFNAENAPNML--RNCWEGRSVRASSLLRQLAKGGCAA 411 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 163 LAAHPPFASWRNSEEARTDRPSQQLR 188 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHP 167 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 853 LAAHPPFASWRNSEEARTDRPSQQLR 878 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 886 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 36 LAAHPPFASWRNSEEARTDRPSQQLR 61 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 80 LAAHPPFASWRNSEEARTDRPSQQLR 105 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 54 LAAHPPFASWRNSEEARTDRPSQQLR 79 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 93 LAAHPPFASWRNSEEARTDRPSQQLR 118 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 55 LAAHPPFASWRNSEEARTDRPSQQLR 80 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWEN GVTQLNRL P Sbjct: 35 LAVVLQRRDWENTGVTQLNRLAAHP 59 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 87 LAAHPPFASWGNSEEARTDRPSQQLR 112 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/31 (77%), Positives = 25/31 (80%), Gaps = 1/31 (3%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSPAG 285 LAVVLQRRDWENPGVTQLNRL H P + G Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWG 97 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 76 LAAHPPFASWRNSEEARTDRPSQQLR 101 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHP 80 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 89 LAAHPPFASWRNSEEARTDRPSQQLR 114 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 85 LAAHPPFASWRNSEEARTDRPSQQLR 110 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQR DWENPGVTQLNRL P Sbjct: 65 LAVVLQRLDWENPGVTQLNRLAAHP 89 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 276 LAAHPPFASWRNSEEARTDRPSQQLR 301 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHP 280 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWEN GVTQLNRL P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 134 LAAHPPFASWRNSEEARTDRPSQQLR 159 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 167 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 70 LAAHPPFASWRNSEEARTDRPSQQLR 95 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 56 LAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 57 LAAHPPFASWRNSEEARTDRPSQQLR 82 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 121 LAAHPPFASWRNSEEARTDRPSQQLR 146 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHP 125 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 134 LAAHPPFASWRNSEEARTDRPSQQLR 159 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHP 138 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 59 LAAHPPFASWRNSEEARTDRPSQQLR 84 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 40 LAAHPPFASWRNSEEARTDRPSQQLR 65 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 78 LAAHPPFASWRNSEEARTDRPSQQLR 103 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 57 LAAHPPFASWRNSEEARTDRPSQQLR 82 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 54 LAAHPPFASWRNSEEARTDRPSQQLR 79 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 31 LAAHPPFASWRNSEEARTDRPSQQLR 56 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 39 LAAHPPFASWRNSEEARTDRPSQQLR 64 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 416 LAAHPPFASWRNSEEARTDRPSQQLR 441 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHP 420 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 65 LAAHPPFASWRNSEEARTDRPSQQLR 90 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHP 69 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 74 LAAHPPFASWRNSEEARTDRPSQQLR 99 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 56 LAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 139 LAAHPPFASWRNSEEARTDRPSQQLR 164 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHP 143 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 75 LAAHPPFASWRNSEEARTDRPSQQLR 100 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 85 LAAHPPFASWRNSEEARTDRPSQQLR 110 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 88 LAAHPPFASWRNSEEARTDRPSQQLR 113 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHP 92 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 434 LAAHPPFASWRNSEEARTDRPSQQLR 459 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHP 438 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 131 LAAHPPFASWRNSEEARTDRPSQQLR 156 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHP 135 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 87 LAAHPPFASWRNSEEARTDRPSQQLR 112 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 76 LAAHPPFASWRNSEEARTDRPSQQLR 101 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHP 80 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 66 LAAHPPFASWRNSEEARTDRPSQQLR 91 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHP 70 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWEN GVTQLNRL P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 181 LAAHPPFASWRNSEEARTDRPSQQLR 206 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHP 185 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 85 LAAHPPFASWRNSEEARTDRPSQQLR 110 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 72 LAAHPPFASWRNSEEARTDRPSQQLR 97 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHP 76 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 108 LAAHPPFASWRNSEEARTDRPSQQLR 133 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 74 LAAHPPFASWRNSEEARTDRPSQQLR 99 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWEN GVTQLNRL P Sbjct: 54 LAVVLQRRDWENTGVTQLNRLAAHP 78 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 57 LAAHPPFASWRNSEEARTDRPSQQLR 82 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 83 LAAHPPFASWRNSEEARTDRPSQQLR 108 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 26 LAAHPPFASWRNSEEARTDRPSQQLR 51 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/56 (41%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 194 HWPSFYNVVTGKTLALPNLIACST-SPFRQLX**RRGPHRSPFPTVAXLNGEWQIV 358 HWPSFYNVVTGKTL + L + PF P + LNGEW+++ Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 60 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 62 LAAHPPFASWRNSEEARTDRPSQQLR 87 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHP 66 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 205 LAAHPPFASWRNSEEARTDRPSQQLR 230 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHP 209 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 54 LAAHPPFASWRNSEEARTDRPSQQLR 79 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 60 LAAHPPFASWRNSEEARTDRPSQQLR 85 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 74 LAAHPPFASWRNSEEARTDRPSQQLR 99 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 71 LAAHPPFASWRNSEEARTDRPSQQLR 96 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHP 75 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 54 LAAHPPFASWRNSEEARTDRPSQQLR 79 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 55 LAAHPPFASWRNSEEARTDRPSQQLR 80 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHP 59 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 69 LAAHPPFASWRNSEEARTDRPSQQLR 94 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 59 LAAHPPFASWRNSEEARTDRPSQQLR 84 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 152 LAAHPPFASWRNSEEARTDRPSQQLR 177 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 185 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 61 LAAHPPFASWRNSEEARTDRPSQQLR 86 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 104 LAAHPPFASWRNSEEARTDRPSQQLR 129 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 42 LAAHPPFASWRNSEEARTDRPSQQLR 67 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 173 LAAHPPFASWRNSEEARTDRPSQQLR 198 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 206 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 360 LAAHPPFASWRNSEEARTDRPSQQLR 385 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHP 364 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWEN GVTQLNRL P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 110 LAAHPPFASWRNSEEARTDRPSQQLR 135 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWEN GVTQLNRL P Sbjct: 90 LAVVLQRRDWENTGVTQLNRLAAHP 114 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 77 LAAHPPFASWRNSEEARTDRPSQQLR 102 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 41 LAAHPPFASWRNSEEARTDRPSQQLR 66 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 67 LAAHPPFASWRNSEEARTDRPSQQLR 92 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/54 (51%), Positives = 31/54 (57%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 L VVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 47 LDVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 129 LAAHPPFASWRNSEEARTDRPSQQLR 154 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHP 133 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRD EN GVTQLNRL P Sbjct: 29 LAVVLQRRDGENTGVTQLNRLAAHP 53 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 106 LAAHPPFASWRNSEEARTDRPSQQLR 131 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHP 110 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 56 LAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 80 LAAHPPFASWRNSEEARTDRPSQQLR 105 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 314 LAAHPPFASWRNSEEARTDRPSQQLR 339 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 294 LAVVLQRRDWENPGVTQLNRLAAHP 318 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 77 LAAHPPFASWRNSEEARTDRPSQQLR 102 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 78 LAAHPPFASWRNSEEARTDRPSQQLR 103 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 36 LAAHPPFASWRNSEEARTDRPSQQLR 61 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 56 LAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 431 LAAHPPFASWRNSEEARTDRPSQQLR 456 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 411 LAVVLQRRDWENPGVTQLNRLAAHP 435 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 115 LAAHPPFASWRNSEEARTDRPSQQLR 140 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 95 LAVVLQRRDWENPGVTQLNRLAAHP 119 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 71 LAAHPPFASWRNSEEARTDRPSQQLR 96 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHP 75 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 63 LAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWEN GVTQLNRL P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 62 LAAHPPFASWRNSEEARTDRPSQQLR 87 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWEN GVTQLNRL P Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHP 66 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 113 LAAHPPFASWRNSEEARTDRPSQQLR 138 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHP 117 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 63 LAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 231 LAAHPPFASWRNSEEARTDRPSQQLR 256 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 211 LAVVLQRRDWENPGVTQLNRLAAHP 235 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 63 LAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 233 LAAHPPFASWRNSEEARTDRPSQQLR 258 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 266 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 53 LAAHPPFASWRNSEEARTDRPSQQLR 78 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 348 LAVVLQRRDWENPGVTQLNRL H P + A+ P S EWR+ Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 255 LAAHPPFASWXNSEEARTDRPSQQLR 332 LAAHPPFASW NSEEARTDRPSQQLR Sbjct: 49 LAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +1 Query: 196 LAVVLQRRDWENPGVTQLNRLQHIP 270 LAVVLQRRDWENPGVTQLNRL P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,726,495 Number of Sequences: 59808 Number of extensions: 504197 Number of successful extensions: 7874 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7818 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2538363813 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -