Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0207.Seq
         (668 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z70038-2|CAA93885.2|  399|Caenorhabditis elegans Hypothetical pr...    28   5.2  

>Z70038-2|CAA93885.2|  399|Caenorhabditis elegans Hypothetical
           protein ZK1067.3 protein.
          Length = 399

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 7/69 (10%)
 Frame = +1

Query: 433 VSQAPSPESNPDSPLPVT-------TMVVAETTSKVDKADI*KMRRRYLTMRSAKVIQIH 591
           +S   SPE N   P+P+T        M +AE  S V +    K ++R  +M  A  ++  
Sbjct: 326 ISAVKSPEKNSHGPIPITPLGSILEAMNIAEEDSDVQEYVPEKKKKRRSSMMKAGAVRRR 385

Query: 592 QN*RLRTRG 618
              R   RG
Sbjct: 386 STLRRSARG 394


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,234,042
Number of Sequences: 27780
Number of extensions: 320201
Number of successful extensions: 926
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 838
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 926
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1508017654
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)