BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0200.Seq (597 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 24 3.2 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 23 9.9 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 24.2 bits (50), Expect = 3.2 Identities = 13/53 (24%), Positives = 25/53 (47%) Frame = +2 Query: 26 KLNKCREWFNRTVKIDPDLGDAWAYFYKFELLHGNEQQQEDVKSRCRAAEPHH 184 K++ ++ NRTV + + Y Y+ EL+ + Q + + +C HH Sbjct: 303 KVSFIEQYTNRTVVKQSQI-TVYRYAYRVELIKESPQFRPGLPFKCALQFTHH 354 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 22.6 bits (46), Expect = 9.9 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = +2 Query: 98 YFYKFELLHGNEQQQEDVKSRCRAAEPHHGEYWCKVSKDIVNW 226 Y + E+L G + ED+K + V+K++ NW Sbjct: 246 YNEREEMLRGVRTRIEDLKMVLGQTQDQRQRVLLNVAKEVPNW 288 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 631,713 Number of Sequences: 2352 Number of extensions: 12689 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -