BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0197.Seq (872 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1827 + 40169001-40169263,40169358-40169472,40170090-401702... 30 2.1 04_04_0561 - 26250488-26251451,26251499-26251620 29 3.7 >01_06_1827 + 40169001-40169263,40169358-40169472,40170090-40170201, 40170556-40170623,40170798-40170852,40170948-40171027, 40171811-40171924,40172178-40172296,40173064-40173181, 40173264-40173394,40173535-40173688,40173922-40174017 Length = 474 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 194 CLSSSRTSPPPCLCSVSG*ISLRFCSDFPFSRGXLRRWLC 75 C PP L V DF FSRG LR W C Sbjct: 92 CTHEVDLDKPPVLQEVENFFKGHGVGDFTFSRGRLREWRC 131 >04_04_0561 - 26250488-26251451,26251499-26251620 Length = 361 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -1 Query: 329 ITSLLETTMLIASVFQTSMLQTLFQPPCSKLPCSRP 222 +T + IA +F + PPCS LPC RP Sbjct: 210 LTESASSPCAIAGLFTLPPPAIIASPPCSTLPCLRP 245 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,896,310 Number of Sequences: 37544 Number of extensions: 357015 Number of successful extensions: 884 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 883 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2456227356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -