BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0197.Seq (872 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK127311-1|BAC86927.1| 223|Homo sapiens protein ( Homo sapiens ... 33 1.0 AK090448-1|BAC03429.1| 700|Homo sapiens FLJ00369 protein protein. 31 5.5 >AK127311-1|BAC86927.1| 223|Homo sapiens protein ( Homo sapiens cDNA FLJ45380 fis, clone BRHIP3020733. ). Length = 223 Score = 33.5 bits (73), Expect = 1.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 281 TSMLQTLFQPPCSKLPCSRPAEAIWCSM 198 TS+ T+ PP L C PAEA+WC + Sbjct: 174 TSLPDTMMLPPSRALWCHLPAEALWCRL 201 >AK090448-1|BAC03429.1| 700|Homo sapiens FLJ00369 protein protein. Length = 700 Score = 31.1 bits (67), Expect = 5.5 Identities = 18/38 (47%), Positives = 20/38 (52%) Frame = -1 Query: 260 FQPPCSKLPCSRPAEAIWCSMLCLSSSRTSPPPCLCSV 147 F+PPC P R A A WC L +PPP LCSV Sbjct: 583 FKPPCPLPPTPRLAPASWCPSL-------NPPP-LCSV 612 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,165,625 Number of Sequences: 237096 Number of extensions: 1864147 Number of successful extensions: 4652 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4652 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11104084400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -