BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0183.Seq (928 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54240.1 68416.m05995 hydrolase, alpha/beta fold family prote... 31 0.82 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 31 0.82 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 31 0.82 At1g74300.1 68414.m08604 esterase/lipase/thioesterase family pro... 30 1.9 At5g22460.2 68418.m02620 esterase/lipase/thioesterase family pro... 29 3.3 At5g22460.1 68418.m02619 esterase/lipase/thioesterase family pro... 29 3.3 At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain... 29 3.3 At3g26510.3 68416.m03306 octicosapeptide/Phox/Bem1p (PB1) domain... 29 3.3 At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain... 29 3.3 At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain... 29 3.3 At1g51965.1 68414.m05859 pentatricopeptide (PPR) repeat-containi... 29 5.8 >At3g54240.1 68416.m05995 hydrolase, alpha/beta fold family protein low similarity to SP|P22862|ESTE_PSEFL Arylesterase (EC 3.1.1.2) (Aryl-ester hydrolase) {Pseudomonas fluorescens}; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 350 Score = 31.5 bits (68), Expect = 0.82 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 492 PPEARCGGPRGPPHTAP 442 PP RCG P GPP TAP Sbjct: 28 PPPKRCGTPGGPPITAP 44 >At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 31.5 bits (68), Expect = 0.82 Identities = 20/66 (30%), Positives = 27/66 (40%) Frame = -2 Query: 498 HNPPEARCGGPRGPPHTAPAAAESVLNWCX*TDSNPSSSTCPAWALRHSPLPSRPPHEPG 319 H PP + CG P P + + S + T S PS + P H+P P PP G Sbjct: 51 HTPPSSNCGSPPYDPSPSTPSHPSPPSHTP-TPSTPSHTPTP-HTPSHTPTPHTPPCNCG 108 Query: 318 GLSALP 301 + P Sbjct: 109 SPPSHP 114 >At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 31.5 bits (68), Expect = 0.82 Identities = 20/66 (30%), Positives = 27/66 (40%) Frame = -2 Query: 498 HNPPEARCGGPRGPPHTAPAAAESVLNWCX*TDSNPSSSTCPAWALRHSPLPSRPPHEPG 319 H PP + CG P P + + S + T S PS + P H+P P PP G Sbjct: 51 HTPPSSNCGSPPYDPSPSTPSHPSPPSHTP-TPSTPSHTPTP-HTPSHTPTPHTPPCNCG 108 Query: 318 GLSALP 301 + P Sbjct: 109 SPPSHP 114 >At1g74300.1 68414.m08604 esterase/lipase/thioesterase family protein low similarity to 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Rhodococcus sp. RHA1] GI:8978311; contains Interpro entry IPR000379 Length = 346 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 507 TMLHNPPEARCGGPRGPPHTAP 442 ++L PP CG P GPP TAP Sbjct: 22 SILKPPPPNLCGSPGGPPITAP 43 >At5g22460.2 68418.m02620 esterase/lipase/thioesterase family protein low similarity to 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Rhodococcus sp. RHA1] GI:8978311, SP|Q02104 Lipase 1 precursor (EC 3.1.1.3) (Triacylglycerol lipase) {Psychrobacter immobilis}; contains Interpro entry IPR000379 Length = 340 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 555 FAVSMQIYKFCICL*FTMLHNPPEARCGGPRGPPHTAP 442 F+V++ I I + PP CG P GPP T+P Sbjct: 3 FSVTVAILVCLIGYIYRSFKPPPPRICGHPNGPPVTSP 40 >At5g22460.1 68418.m02619 esterase/lipase/thioesterase family protein low similarity to 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Rhodococcus sp. RHA1] GI:8978311, SP|Q02104 Lipase 1 precursor (EC 3.1.1.3) (Triacylglycerol lipase) {Psychrobacter immobilis}; contains Interpro entry IPR000379 Length = 340 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 555 FAVSMQIYKFCICL*FTMLHNPPEARCGGPRGPPHTAP 442 F+V++ I I + PP CG P GPP T+P Sbjct: 3 FSVTVAILVCLIGYIYRSFKPPPPRICGHPNGPPVTSP 40 >At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = -2 Query: 495 NPPEARCGGPRGPPHTAPAAAESVLNWCX*TDSNPSSSTCPAWALRHSPLPSRPP 331 NPP++ G + PP P A S + ++ +SS+ + +L PLP PP Sbjct: 113 NPPKSAAGSKKSPP---PLALPSSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPP 164 >At3g26510.3 68416.m03306 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 218 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = -2 Query: 495 NPPEARCGGPRGPPHTAPAAAESVLNWCX*TDSNPSSSTCPAWALRHSPLPSRPP 331 NPP++ G + PP P A S + ++ +SS+ + +L PLP PP Sbjct: 135 NPPKSAAGSKKSPP---PLALPSSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPP 186 >At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = -2 Query: 495 NPPEARCGGPRGPPHTAPAAAESVLNWCX*TDSNPSSSTCPAWALRHSPLPSRPP 331 NPP++ G + PP P A S + ++ +SS+ + +L PLP PP Sbjct: 113 NPPKSAAGSKKSPP---PLALPSSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPP 164 >At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = -2 Query: 495 NPPEARCGGPRGPPHTAPAAAESVLNWCX*TDSNPSSSTCPAWALRHSPLPSRPP 331 NPP++ G + PP P A S + ++ +SS+ + +L PLP PP Sbjct: 113 NPPKSAAGSKKSPP---PLALPSSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPP 164 >At1g51965.1 68414.m05859 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 650 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -2 Query: 717 LRSRRFXSIERYVRPNXXYYEXKHEYXVTSQLTGG 613 LR R F S+ RPN +Y K+ VTS G Sbjct: 4 LRRRFFNSVNTITRPNRRHYATKYVAKVTSSSPSG 38 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,898,127 Number of Sequences: 28952 Number of extensions: 320279 Number of successful extensions: 678 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2207676696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -